新编大学英语视听说第3册听力原文和答案

Interviewer: Angela, you were born in Korea but you've been living in Canada for a long time, haven't you?Angela: Yes, I was 10 years old when my parents immigrated to Canada and I've been living here for 20 years now.Interviewer: Do you think that belonging to two different cultures has affected your personality?Angela: Yes, definitely. There are times when I think that I have two personalities. Depending on where I am and who I'm with, I'm Korean or I'm Canadian.Interviewer: That sounds complicated. Could you explain what you mean?Angela: Well, growing up in Canada when I was going to high school, for example, I was known as Angela to the outside world, and as Sun-Kyung at home. I would wave hello to my teachers, but bow to my parents' Korean friends when they visited our home.Interviewer: Do different cultures have different ideas as to what is polite?Angela: Yes, definitely. In high school, I was expected to look straight in the eyes of my teachers and to talk openly with them. But when Koreans spoke to me, I was expected to look at my feet and to be shy and silent.Interviewer: Do you think that having two personalities makes you a richer person?Angela: Yes, but sometimes I don't know who I am.I am a very sensitive person, and that's good to a point. I feel everyone should be able to feel or understand what others are going through. But when you hurt, cry, or are unhappy for people you don't know, or for a movie that is not real, then I think that's a little too sensitive. That's the way I am.I am a very independent person. I must do things for myself. I don't like people doing things for me, or helping me, or giving me things. It's not that I don't appreciate it, because I do. I just feel that when someone does something for you, you owe them, and if there is one thing I don't like to feel, it's that I owe anyone anything.I think I would be a good friend. I would do almost anything for someone I like, and would share or give anything I have. I'm very caring and understanding. People trust me with their secrets, and they're right for doing so because I never tell any secret that is told to me. I'm always there to help in any way that I can. All you have to do is ask.I enjoy life and people, which makes me feel good. I find fun in almost everything I do (except housework). I like to watch people, talk to them, and be around them. Itmakes no difference whether I agree or disagree with what they feel, or how they live, or what they look like, or what age they are. I just enjoy learning and being aware of everything and everyone around me.Tom: Hey, Bill. Do you have any plans for this weekend?Bill: Yeah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test.Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different. Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!David: Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad with fair hair. Very friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas.David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Yes, there is Maria. She's Susan's sister.David: Yes.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you?Barbara: Thanks.David: Bye.1. Pedro sleeps only six hours a night. He goes to school full-time and workspart-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. You can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of the students threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?A number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help.Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By much nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "You're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself. Statements:1. It was easy to tell the English from the British.2. Speaking the same language helped one Australian visitor a lot.3. By "much nicer", one of the visitors meant that the British people were more friendly than people of other countries.4. The majority of continentals thought highly of English manners.5. To the young student from South Africa, Britain seemed to have a lot of foreign visitors.One day, when Mr. Smith came home from work, he found his wife very upset about something. Mr. Smith always thought that he was more sensible than his wife, so he started to give her a lecture on the importance of always remaining calm.Finally he said, "It's a waste of your strength to get excited about small things. Train yourself to be patient, like me. Now, look at the fly that has just landed on my nose. Am I getting excited or annoyed? Am I swearing or waving my arms around? No. I'm not. I'm perfectly calm."Just as he had said this, Mr. Smith started shouting. He jumped up and began to wave his arms around wildly and swear terribly. He couldn't speak for some time, but at last he was able to tell his wife: The thing on his nose was not a fly, but a bee.Tom: Oh, that Mr. Taylor. He is so boring!Mother: What do you mean?Tom: His lessons put me to sleep. And he's so quick-tempered, Mum.Mother: Quick-tempered? Mr. Taylor? Are you sure darling?Tom: Yes, he gets angry very quickly.Mother: That doesn't sound like Mr. Taylor at all!Tom: And do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother: Really? And why does he do that?Tom: Because he's vain, that's why! And conceited! He thinks he knows everything. Mother: Oh, Tom. Be reasonable. I'm sure you're exaggerating. Mr. Taylor seems such a nice, kind man.Tom: Well, he isn't. He is mean and cruel.Mother: Cruel? Now how can a history teacher be cruel?Tom: Because he only gave me two out of ten points in my history test.Mother: Oh, now I understand. Tom, I think you'd better get on with your homework!(S1 = the first speaker; S2 = the second speaker; S3 = the third speaker; S4 = the fourth speaker)S1: In this week's edition of Up with People we went out into the streets and interviewed a number of people. We asked a question they just didn't expect. Weasked them to be self-critical...to ask themselves exactly what they thought they lacked or—the other side of the coin—what virtues they had. Here is what we heard. S2: Well...I...I don't know really...it's not the sort of question you ask yourself directly.I know I'm good at my job... At least my boss considers me hard-working, conscientious, and efficient. I'm a secretary by the way. When I look at myself in a mirror as you sometimes do in the privacy of your own bedroom...or at your reflection in the shop windows as you walk up the street... Well...then I see someone a bit different. Yes...I'm different in my private life. And that's probably my main fault I should say... I suppose I'm not coherent in my behavior. My office is always in order...but my flat! Well...you'd have to see it to believe it.S3: Well...I'm retired, you know. Used to be an army officer. And...I think I've kept myself...yes, I've kept myself respectable the whole of my life. I've tried to help those who depend on me. I've done my best. I am quite self-disciplined. Basically I'm a good guy, fond of my wife and family... That's me.S4: Well...when I was young I was very shy. At times I...I was very unhappy...especially when I was sent to boarding school at age seven. I didn't make close friends till later...till I was about...fifteen. Then I became quite good at being by myself. I had no one to rely on...and no one to ask for advice. That made me independent. My wife and I have two sons. We...we didn't want an only child because I felt...well I felt I'd missed a lot of things.Mike: Hey, guys. Come and look. I've found an interesting Web site on star signs. (The others come close to the computer and look at the star signs on the screen.) Ted: Hey, that's interesting! What's your sign, Sam?Sam: I'm a Scorpio. What's yours, Ted?Ted: I have no idea. I've never really thought about that. Let's have a look. I was born on September 5. Oh, I'm a Virgo.Simon: And I'm a Libra.Sam: What do they say about Libra, Simon?Simon: (He reads.) You're a sociable, charming person. You go out of your way to avoid confrontation and do everything in your power to make your life an easy one. Although you're generally likeable, you can be changeable, superficial and critical. But you manage to hide those traits most of the time.Mike: Do you agree with that? Are you that type of person?Simon: What do you think? I think there is something in what it says. I am social and outgoing. But I am not changeable, am I? What's your sign, Mike?Mike: I'm a Taurus. Ah, what's yours, Lilly?Lilly: I'm a Cancer.Ted: Now let's look at Taurus.( He reads.) You're a patient, practical type. Good points include your affectionate, kind nature, your trustworthiness and strength of character. Bad points include your possessiveness, self-indulgence and stubbornness. Do you think your character fits well?Mike: No, not at all. I'm not patient, and I'm not practical either. I am kind ofquick-tempered and ambitious. That's definitely not me! But one thing is right: I AM stubborn.Simon: Sam, let me read yours. (He reads.) You are secretive, and sexy. You have the worst reputation in the zodiac. Scorpio has a dark side, which includes revengeful and destructive traits. Yet despite this, you can be the wittiest, kindest and most entertaining of all the signs.Sam: Oh, that can't be true! Are you sure you were reading Scorpio?Simon: Yes, of course! Look for yourself.Sam: But that's unfair! I have the worst reputation in the zodiac?!The others: (They all laugh and say.) Ha ha... Poor Sam!Sam: Who could believe such silly things! Really, I think I'm intelligent, humorous, and kind-hearted.Mike: Yes, but those are just your good traits. Don't forget about your bad ones! Sam: Come on! Oh, Lilly, we haven't looked at your sign yet. Eh, you are a Cancer, right? You want me to read yours?Lilly: No, thanks. I'm afraid you'll distort what's written there. Let me read it myself. (She reads.) To some people, you appear tough and determined, but that's just a "front" you put up to protect the real you, which is rather more sensitive and softer. You can be moody, touchy and irritable, but you make up for those negative traits with your kindness, great intuition and protective nature. That's not bad, is it? Simon: No. But what counts is not what it says, but how you really are, what you are actually like.Lilly: (She is a bit defensive.) What do you mean? What are you trying to say about me?Simon: I think you are much nicer than what it describes.(Lilly smiles.)The other boys: Oh, Simon, don't sweet-talk her! We know what you are thinking. Ted: Hey, I haven't seen mine yet. Now it's my turn.Mike: Go ahead, Ted! Be our guest!Ted: It says: Virgo people like order in all things and are neat, clean and precise in their habits. Virgo people are perfectionists and they sometimes can be critical. They do not like to draw attention to themselves. Virgo people are modest, and careful about what they eat or drink.Sam: Do you have any objections to that?Ted: I think the description matches me quite well. I AM a perfectionist. I like things to be in order. Erm, I...I'm careful about what I eat and drink. But it doesn't mention my weak points.Lilly: Oh! And what are those?Ted: Well, sometimes I'm so careful I tend to waste a lot of time. I'm not very sociable, and I don't have many friends.Sam: I think everyone has some undesirable personality traits that could be improved. Don't you think we all could improve our personalities?Mike: I think we can. For example, my little sister was the youngest girl in our family. My parents loved her very much, but they spoiled her by giving her too much. She was at that time self-centered, selfish, aggressive, bad-tempered, and rude. Her personality didn't change any until she entered primary school. In school, she first acted as she did at home, and she couldn't make a single good friend. For a time, she was even isolated by her classmates. She complained to us, and finally understood her problem. From then on, she made every effort to get rid of her undesirable characteristics both at home and in school. Now she's in middle school and has turned into a popular girl.Lilly: In my opinion, our personalities are partly inherited and partly shaped by our home environment. As we all know, scientists have found that parents' personality traits can be seen in their children. Most children have some of their parents' personality traits.Mike: That's right. And our early home and school environment also has a big influence on the shaping of our personality. For instance, I've noticed that many children growing up in rich families may become wasteful, lazy, arrogant or cold. On the other hand, I've noticed that many children raised in poor families arehard-working, caring, sympathetic, and helpful.Sam: Does that mean you think we have to choose our parents wisely?(The others laugh.)2Mart Moody from Tupper Lake used to tell this tale. "I went out one day and there was a big flock of ducks out on Tupper Lake. And I had this good dog. I shot at the ducks, and then I sent the dog out there. She was heavy with pups at the time, and I didn't know whether I should send her out there. It was a cold day in the fall. Well, she took right off and away she went. But she didn't show up when it got dark. I began to worry about her. She was a good dog, a really good retriever. She'd get anything I shot at."So the next morning I woke up and I thought I'd better go and see if I could find her. And I got down to the shoreline of the lake and I looked out. Suddenly I saw something coming. It was this dog. She came into the shore! She had three ducks in her mouth. And behind her she had seven pups. And each of the pups had a duck in his mouth."There was an old man who had a daughter. He told his daughter that he had invited a preacher to his house. He said, "Daughter, I'm going down to the train to meet the Reverend, and I've roasted two ducks and left them there for him in the other room. Don't you touch them!" The daughter said, "No, I won't touch them." So her papa went to the train to meet the Reverend, and the girl began to taste the ducks. The ducks tasted so good that she kept on tasting them until she had eaten them all up, every bit of them.After the old man came back, he didn't even look in the place where he had left the ducks. He went directly into the other room to sharpen his knife on the oilstone so he could carve the ducks. The preacher was sitting in the room with the girl. She knew that her papa was going to punish her, and she started crying and shedding tears. The preacher asked, "What is the matter with you, girl?" She said, "Papa has this one bad fault: He invites preachers to his house and goes to sharpen his knife to cut off both their ears." And the Reverend asked, "What is that you say, daughter?" The girl said, "Yes, Papa invites preachers here all the time and cuts off both their ears." The preacher said, "Daughter, hand me my hat. Quick!" The girl gave him his hat and he ran out of the door quickly. The daughter called her papa and said, "Papa, the preacher got both the ducks and has gone." The old man ran to the door and yelled tothe preacher, "Hey, where are you going in such a hurry? Come back here right now!" But the preacher just kept running and shouted back over his shoulder, "Damned if you'll get either one of these."Jack Storm was the local barrel maker and blacksmith of Thebes, Illinois. He had a cat that stayed around his shop. The cat was the best mouse catcher in the whole country, Jack said. He kept the shop free of rats and mice. But, one day, the cat got caught in a piece of machinery and got a paw cut off. After that, he began to grow weak and thin and didn't take any interest in anything, because he wasn't getting enough to eat.So, one day, Jack decided to make a wooden paw for the cat. He made it with his pocket knife and fastened it on the injured leg. After that, the cat began to grow sleek and fat again. Jack decided to stay at the shop one night to see how the cat managed with his wooden paw.After dark, the cat got down in front of a mouse hole and waited. Pretty soon a mouse peered out cautiously. Quick as a flash the cat seized it with his good paw and knocked it on the head with his wooden one. In no time, that cat had eighteen mice piled up in front of the mouse hole.Ken: Hey, Josh. Where did you get those comic magazines?Josh: When I went home last weekend, I found these old Superman magazines that my older brother had bought many years ago.Ken: You don't have time to read old comics. Why did you bring them here?Josh: In my World Literature class we've been talking about the importance of myths, folk tales, and legends to cultures. We have to write a short paper on which legendary figure we think is the great American hero. I think it's Superman.Ken: Superman? Why? I think it's someone like Paul Bunyan, the giant woodsman, or Johnny Appleseed, who planted early apple trees in the Midwest. Superman is just a modern comic magazine character.Josh: When I saw these old comics, I started thinking that Superman represents a combination of cultural traditions and beliefs that have been told throughout our American history.Ken: How?Josh: Superman is an orphan who comes by rocket to Earth when his native planet explodes. He lands near a small town and is adopted by Jonathan and Martha Kent, who teach him their American middle-class values of honesty, hard work andconsideration for others. As an adult, he migrates to a large city and defends Americans against evil.Ken: What else?Josh: Well, I was thinking about this and realized that he is a symbol of the American character because he is an immigrant. We Americans have come from somewhere else, too. My great grandparents came from Germany, and I know your grandparents came from Brazil. They all worked hard and succeeded.Ken: But how does that relate to Superman?Josh: He goes to the city, just as many immigrants did, works as a newspaper reporter. But his adopted parents' values of honesty, hard work and helpfulness are a part of him. He uses his super abilities to fight dishonesty and to help the victims of crime and injustice, meanwhile working hard at his newspaper job.Ken: I understand. As an orphan, Superman becomes a new person in a new land, just as our ancestors did, and succeeds. He also represents our values. Your paper should be interesting. I'd like to read it when it's finished.Josh: OK.At one time animals and people lived together in peace and talked with each other. But when mankind began to multiply rapidly, the animals were crowded into forests and deserts.Man began to destroy many animals for their skins and furs instead of only for food. Animals became angry at this treatment by man and decided that mankind must be punished.The animals held a meeting, but they could not decide how to punish mankind. Finally the animals agreed that because deer were the animals most often killed by man, deer should decide how man should be punished.Deer decided that any Indian hunters who killed deer without asking pardon in a suitable manner would be made to suffer with painful stiffness in their bodies. After this decision was made, the leader of the deer sent a message to the nearest people, the Cherokee Indians. "From now on, your hunters must first offer a prayer to the deer before killing him. You must ask his pardon, telling the deer you are forced to kill him only because your people are hungry and need meat. Otherwise, a terrible disease will come to you."The spirits of the deer would run to the place where a deer had been killed and these spirits would ask the dead deer, "Did you hear the hunter's prayer for pardon?" If theanswer was "yes", the spirits would be satisfied. But, if the answer was "no", then the deer spirits would track down the hunter to his house and strike him with the terrible disease of stiffness in his body, making him crippled so that he could not hunt deer again.Soon all of the animals agreed that this was a fair and just punishment. Each type of animal decided that they would also cause a disease in people who mistreated them.When the friendly plants of the world heard what the animals had decided as punishment for mankind, the plants decided that this punishment was too harsh. They had a meeting of their own. Finally they decided that each type of plant should provide a cure for one of the diseases which animals had caused for mankind.This was the beginning of plant medicines from nature among the Cherokee Indians a long, long time ago.Every March, a flock of buzzards returns to the town of Hinkley, Ohio. No one really knows how long this event has taken place, but according to local legend the annual buzzard migration began nearly 200 years ago with a massacre."The first legend of buzzards in Hinkley, Ohio, goes back to the Great Hinkley Hunt on December 24, Christmas Eve, in 1818. The local settlers deciding that the township needed to be made safe for their livestock, gathered together about 400 men and boys, with guns and clubs and completely surrounded the township of Hinkley." As the story goes, the townsfolk began marching toward the center of town, drivingall the game in front of them, and killing virtually every wild animal they encountered."The settlers took some of the deer and the wild turkeys for the holiday dinners, but left all of the other dead animals out in the snow. When spring came, the remaining dead animals attracted many buzzards, and since 1819 they've been coming back here in March."Hinkley locals have come to appreciate the buzzards' annual return. In mid-March, on Buzzard Sunday, they celebrate the birds' arrival with costumes, exhibits and songs. Almost seven centuries ago, in Central Asia, there lived a great king called Tamerlane. He was a mighty, powerful, conquering soldier, and his greatest ambition was that one day he would rule a massive empire stretching from the Atlantic Ocean in the west to the Pacific Ocean in the east. He made his imperial capital in the oasis city of Samarkand, which he planned to make the most beautiful city on earth. Many magnificent mosques were built and they were decorated with exquisite blue ceramic tiles on the outside, and with pure gold on the inside.。

合集下载

【精品】新编大学英语第三版视听说3听力答案(Unit1-Unit6)

Unit 1PART 1Listening 11. FFTTFT2.outside worldat homewave hellobowlook straight into the eyesopenlylook at my feetshy and silentListening II1.1.sensitive independent2.good friend3.life people4.learning being aware2.BCADBListening III1.1.ice-skating2.chemistry3.outgoing, bright, funny4.self-centered5.blond medium height6.runner-up2. TFTFFLstening IV1.1. Four2.Colleagues3.Teacher./Teaching4.Susan5. To go on holiday2.1.Paul:DEJ2. Susan: B F3. Maria: C H4. Peter: AGIPART 21.1.Mike C2Sam E3.Ted D4.Simon A5.Lilly B2.avoid confrontationgenerally likeablehide those traitsaffectionate kind nature stubbornnessworst reputationrevengeful and destructive entertainingtough and determinedintuition and protective nature perfectionistsdraw attentionPART 31.1. The lunar calendar2.Two trines3.Four trines2. who is very good with money who is easily angereddisplay the utmost amount of energy longest life and good fortunewith quick witgreat common senseinspires leadership in others seductive and charmingdeep-thinking and very talented interesting and bravePART 4Listening 1upsetsensiblelecturecalmstrengthlandedswearingperfectlywildlybeeListening II1.BDAACCDCListening III1.1 PELedro C2 Mr. Miller C3. Mr. Smith E4 Jake A5 Mrs. Duke F2.1.favorite way to relax2.how to divide3.bad unripe4.stiff sore5.fastening a basketball hoop Listening IV1.FTFFT2.understand the Scots' English the friendliest peoplemuch nicer thanEngish courtesyno views on the matterUnit 2Listening I1. BABD D(最后一个答案存在疑问，应选C，请读者参考听力录音确认)2. FTTFTListening II1. AABCD2. TFTTFFListening III1.1) stayed around2)mouse catcher3)rats and mice4)got a paw5)weak and thin6)make a wooden paw7)fastened it8)grow sleek and fat9)managed10) peered out cautiously11)seized it with12) 18 miceListening IV1. BDAAC2. FTTTFTFFPART 21.1 C2 E3 D4 B5 A2. in your handused to belong topracticing withtalked to each otherwhy notask forfind a waymanage tohis own loveso foolishly jealousall three of thempeacePART 31. DCABA2.InvadesheltersupplypeacewithdrawflaghangedremembersecretsharequeenPART 4Listening 11. BCBADA2. FFTTFListening II1. 1. CDJ2.AEGH3.BFI2. ABDCBDListening IIITFFFTFTTListening IVassociatedrailroadmerchantdictionariesgrasslandsbringactionOne hundred days after his offer was made, the first herds arrived from the South.Soon there were at least 5000 cowboys bringing cattle up to Kansas from Texas.These photos were published in eastern newspapers and the cowboy became an American folk hero.Unit 3Part 1Listening 11. BCDA2. FTFTFTListening II1. BDAD2. 30smale190long wavyheavily builtlight red sweaterbeardListening III1. BCAC2.lovetogethermotherhouseschoolfriendsfathermonthbeachcallListening IV1. Stories music next door in love with secretary fights3×4 √2. Celia: 1 √2 √3×4√Sara 1×2 √　2×3×4√Jack 1 √　4×Tom 1√2 √ 3√PART 211D 2C 3 B 4 E 5 A3. TFFTTTTTFFPART 31.a central bodytransport visionaccessa race trackslightly slowerhuge success2. car movementcyclingwalkingstrategiesquality of lifevisit the cityinvestmentdesignenvironmentsubtle designfocusPART 4Listening 11．FTFT2．South Americapet foodenough proteindevelopmuch moreAfricapositionnatural resourcesgone downsteadycontinued to risegetting richer and richerListening II1.the first few secondsso thinbeings from another planetfocused onlooked directly atAll arounduntil nowdespair grief and disguststarted cryingwho was sleeping peacefully6×7×8√2. 1√2 √3×4 √5√Listening IIIComplainedworkchestshockedcold-bloodedinvestigationdealingHe had mentioned his concern twice to the local officialWhenever this topic arose he always expressed strong views about drugs.ted to the murder.But it’s still early to say this is relaListening IVpovertycrimedriftbetter workresentmentattractiveeducation servicesa more positive attitudeUnit 4Part 1Listening I×,8√1 1×,2√,3×,4√,5√,6√,721)weaknesses,2) similar abilities and interest, interest you, important and challenging3) education, promotion, educated persons4) parents, teachers, benefit, give careful thought, useful suggestions, personal qualities5) getting money, our future happiness, combinationListening II1.DDAB2.1）import from abroad 2）sales manager 3）salary 4）sales commission5) travel in 6)experience 7)university 8)on a teamListening III11)Choose their careers, 2) avoid certain careers3) different professions, 4) impressions and prejudices, 5) lawyers, 6) accountants, 7) scientists, 8) most popular, 9) least popular, 10) ignorance 2 TFTFTListening IV1.C A C B D2.1)occupation cool2)catch provide fulfilling3)media coming after you make your own work schedule4)have my pick of jobsPart 2×K√L√1. A√B√Ｃ×D√Ｅ×F√G×H√I√Ｊ2 1) computer engineering, 2) computer programmer, 3) internship, 4) lecture, competition, 5) computer programming skills, 6) impatient, 7) constructive, 8) medical research, 9) management, 10) 3600Part 31.A√Ｂ×C√D√Ｅ×F√Ｇ×H√2.1)tremendous element of care, what kinds of contributions2)where you’re from3)professional learning, colleagues, peers4)what makes their students tick5)relaxed, care about them, passionate, developPart 4Listening I1)100 million2)35, 403)seven, eight4)office workers, many professionals5)8:00, 4:006)eight-hour shifts7)Monday, Thursday, Saturdays, Sundays8) choose their own working hours, freedom of choice, happy withListening II1.ADCADListening IIICBDCAListening IV1. CABDB2.1) ADF2)BF3)ACEUnit 5:Part 1：Listening 1:1.1.plays, real people real life, emotional, problem, popular2.public speech, make themselves taller, political, one-sided3.soft-soap, praise, kind2. F F T T T TListening II:1. 1 C 2 A 3 D2.1.be understood easily2.necessary desirable3.splendid4.prevents, from achieving5.anxiety, effectListening III:1.1.T2. F3. F4. F5.T6.T21.fairly good2.ensure, success3.natural, family relationship4.exposure5.visiting or telephoningListening IV:11. C2. C3. A4. B21.eggs, toast2.realistic, far better than, forgetting3.determined, personality culture4.recite aloudPart 2：1．1-B 2-A 3-C 4-E 5-D 6-F2.1.over long distances2.look into it3.five times4.individual group5.sex-specific males females strangers6.great apes7.teach own kind8.raised held look bigger9.round tail-wagging10.feeding every directionPart 31.goat ghost2.Lydia Bernard3.Godfrey Saint John Geoffrey Sinjin4.John Jane5.Johned joined6.Siji…Siji Delaney Sinjin Delaney7.Awful lawful8.Spigot spiritPart 4Listening 11.Economic2.religions3.exist4.biologically5.40,0006.cave7.Written8.humans were probably speaking thousands of years before that9.Even while we are reading or just thinking, we are in a sense“talking”nguage is so much a part of human existence that we will betalking as long as we inhabit the Earth.Listening II1. D A B B A2.1.Permission apply for2.application form website3.regular mail faxcredit cards4.traveler’s checksListening III1A×B√ C √D×E√21)Other native languages2)two3)more4)of their choice5)Spanish6)Indians7)English German FrenchListening IV1.1.learner teacher curriculum2.Curiosity expectations goals2.T F T F TUnit 6PART 1Listening I1. BCDB2. TFFFTFLstening II1.1.snake crocodile2.parrot budgie3.quiet4. goldfish2. ADACALisening III1.CABD2.1.crowding war water grass2.what is happening keep the number of horses low3.target practice where the horses were found4.gotten rid of stayListening IV1. FTFTFTFF2. 1×2×3×4√　5× 6 √PART 21.DABCCA2.1.farm animals hold feed2.small pets toys3.bury toss them out4. real shame5.dangerous destructive bring diseases6.have a point7.humanely limit8.time money warm place9.isolated company10.storm of debatePART 31.ADDBACAB2.1. female collectively2. not a moment3.infinite care4.picks up keft to right5.stuck smarter6.salt water lake dock7.self-aware non-human intelligence belong in captivityPART 4Listening 11.1√ 2×3×4√ 5√ 6√ 7 √ 82.ACCADLstening II1. CBDDA2. 1×2√ 3×4×5√ 6×7√ 8×Lstening III1CADBB2.1.family holiday2.7-foot 18 stones3.stroking adjusting his clothing4.fractured skull black eye broken arm5.lose his love6.cat7.get-well cards presentsLisrening IV1.1）a.whales and dolphinsb.birdsc. tigers2）a. meat oilb.handbags shoesc.furd.ivory2.TFTT。

新编大学英语3视听说教程听力原文U5

Listen 1Every culture has its own way of saying things, its own special expressions. These are the living speech of a people. The "soap" expressions in English are just one example.Soap operas are radio and television plays about the problems and emotions in human relationships. They are called soap operas because the first programs—years ago—were paid for by soap-making companies.Like musical operas, soap operas are not about real people. And critics charge that they do not represent a balanced picture of real life. They note that almost everyone in a soap opera has a serious emotional problem, or is guilty of a crime. And there are several crises in every program.Yet, soap opera fans do not care about what the critics say. They love the programs and watch them every day.Such loyalty has made soap operas very popular in the United States. In fact, a few programs are so popular that they have been produced with the same actors for many years.Another expression that uses the word "soap" is "soap box".There was a time when soap and other products were shipped in wooden boxes. The boxes were small, but strong. You could stand on one to see over the heads in a crowd or to be seen in a crowd. Soap boxes were a simple, easy way to make yourself taller if you wanted to give a public speech.Such soap box speeches usually were political and one-sided. The speakers shouted their ideas to anyone who walked by. Many talked for hours, refusing to get off their soap boxes.Today, you don't need a wooden box to make a soap box speech. Anyone, anywhere, who talks endlessly about a cause, is said to be on a soap box.Another quieter way to win support or gain influence is to "soft-soap" a person. This means to use praise or other kind words to get the person to do what you want.Listen 2A: Do you think learners should aim to speak English with a native-speaker pronunciation?B: That's a difficult question to answer. I think the most important thing is to be understood easily. For most learners, it's not necessary or desirable to speak like a native speaker. For some learners, forexample, those who eventually want to teach English, or be interpreters perhaps, a native-speakerpronunciation is the ultimate goal. At least, that's what I think.A: Children often do not want to speak English with a native-speaker pronunciation. Why not?B: In general, children are splendid mimics and imitate strange sounds very easily and well. However, it is true that most children do not want to sound "English" when they are speaking English. This may be partly due to shyness but I think the main reason is that most children want to belong to a group—they dress alike, listen to the same music, share the same opinions and hobbies. Even if a child can speak English like a native speaker, he or she will usually choose not to—unless, of course, the rest of the group speaks with a native-speaker pronunciation too.A: What is the main reason why adults find pronunciation difficult?B: Numerous reasons have been offered for the difficulties which many adults find with pronunciation and, no doubt, there is some truth in all of these. It seems to be the case that children are better mimics than adults. But if an adult really wants to achieve a native-speaker pronunciation, then he or she can. It is NOT the student's own language that prevents him or her from achieving a native-speaker pronunciation in English. It is the fact that the adult student has a strong sense of national identity. In other words, he or she wants to be identified as a German or Brazilian speaking English. In my opinion, this sense of national identity is more important than other explanations, such as the greater anxiety of adults or the effect of their own language habits.Practice 1R: English Language Center. May I help you?C: Yes. I'm calling to find out more information about your program.R: Well, first of all, the purpose of our program is to provide language-learning opportunities for our partof the U.S. [Uh-huh.] For example, some students need to learn the basic functional language skills for their jobs. Others need intensive English so that they can enter a U.S. university.C: Okay. I'm calling for a friend interested in attending a U.S. university.R: We have a variety of courses that can help her, from basic communication courses to content-based classes such as computer literacy, intercultural communication, and business English.C: Great. What are your application deadlines for the next semester?R: Well, we ask applicants to apply at least two months before the semester begins. This gives us time to process the application and issue the student's I-20.R: Oh, an I-20 is a form giving our permission for a student to study in our program. The student will have to take this form to the U.S. embassy in their home country to apply for the F-1 student visa.C: I see. What's the tuition for a full-time student in your courses?R: It's two thousand thirty dollars.C: How does one apply?R: Well, we can mail an application form which can be mailed back to us, or a person can fill out our application form that's on our Web site.C: And are there other materials my friend would need to send besides the application form?R: Yes. She would need to send in a $35 non-refundable application fee [Uh-huh], a sponsorship form indicating who will be responsible financially for her while studying in our program, and a bankstatement showing that she or her sponsor has sufficient funds to cover tuition expenses and living costs for study.C: And how can she send these materials to you?R: She can either send the application packet by regular mail or she can fax it.C: And the application fee?R: We accept money orders, traveler's checks, or credit cards.C: All right. I think that's about it. Thank you for your help.R: You're welcome.C: Goodbye.Practice 2The ability to speak or write two languages well is called bilingualism. Bilingual education is generally a matter of public policy. In a country like the United States that has what may be considered a national language—English—bilingual education means teaching English to those who were brought up using other native languages. On the other hand, there are nations such as Belgium, Canada, and Switzerland that have two or more national languages. This does not mean that all citizens of these countries speak two or more languages, but they are entitled to government services, including education, in the language of their choice. Some South American countries, like Peru and Ecuador, have large populations of Indians who speak various tribal tongues. There are government programs to teach the Indians Spanish, the national language in most of Latin America.Bilingual education in the United States dates back to the first half of the 19th century, when millions of immigrants who arrived needed to learn English in order to make economic and social adjustments to the way the majority of the population lived.In countries like Norway, Sweden, Denmark, Finland, and Holland, whose languages are spoken by relatively few foreigners, bilingual education has long been a part of the school curriculum. Educated persons in these countries normally learn a second language such as English, German, or French for use in international communication.Practice 3Identification of the factors that lead to fast, effective foreign language learning has become increasingly important because of the large number of people who are anxious, as adults, to learn a new language for a very specific purpose: travel, business, study, or international friendship. The requirements for effective language learning may be examined in terms of the learner, the teacher, and the curriculum.The learner must be personally committed to investing the time, applying the concentrated effort, and taking the emotional risks necessary to learn a new language. In addition to motivation, the learner should have at least minimal language-learning aptitude. While it is likely that nearly everyone can learn a new language if he or she is given enough time and effort, the ease with which you are able to acquire the language is related in part to specific language-learning aptitude. Other psychological factors that are important in picking up a new language include a sense of curiosity and a sensitivity to other people. Expectations also play an important role in determining the ease and speed with which you will learn your second language. Another factor is the learner's goals. If you are a serious adult language learner you need to write and clarify your goal in each specific area: understanding, speaking, reading, and writing.Clearly, the learner and teacher are far more important than techniques, texts, and program design. The most crucial factor involved in determining a language teacher's effectiveness, however, is probably his or her attitude toward the students, toward the language and toward the program. On the other hand, the language used in the classroom should be up-to-date and authentic. You need to learn not only words and structures but how to use them in a way acceptable to people from a different background. A good language curriculum will include practice in the nonverbal aspects of communication as well as discussion of cultural differences and similarities.Practice 4H: Welcome to today's program! Our guest is Dr. Charles Adams, language learning specialist. His book, Learning a Language over Eggs and Toast, is on the bestseller list. Welcome.A: Thank you.H: Tell us about the title of your book.A: First, it is important to establish a regular study program, like planning a few minutes every morning around breakfast time.H: But, I took Spanish for four years, and I didn't become a proficient speaker of it.A: Well, we can't become fluent speakers in a matter of a few minutes here and there. We should follow a regular course of study and remember that there is a difference between native fluency and proficiency in a language. I propose the latter.H: What are the basic keys you suggest?A: People must organize their study by setting realistic and attainable goals. Some people think they can learn a language in 30 days and become discouraged when they can't. Small steps are the key. Learning five new words a day and learning to use them actively is far better than learning 30 and forgetting them the next day.H: You mentioned individual learning styles. Can you explain what you mean by learning styles?A: Sure. People have different ways of learning. Some are visual learners who prefer to see models of the patterns they are expected to learn. Others are auditory learners who favor hearing instructions over reading them. Our preferences are determined by factors such as personality, culture, and pastexperiences.H: What is your learning style?A: I learn by doing.H: What do you mean by that?A: I know it might sound unusual, but moving around while trying to learn material helps me. While I cut up tomatoes and onions for my breakfast in the morning, I might recite aloud vocabulary to the rhythm of the knife.H: What is my learning style?A: You're going to have to read my book to find that out.H: Okay. Thanks for joining us.A: My pleasure.Text 1Language is the most important development in human history. The arts, sciences, laws, economic systems and religions of the world could not exist without language. Humans haven't changed biologically very much for some 40,000 years. However, our ability to communicate has led us from the cave all the way to the moon.Little is known about the birth of language. Written records that are more than 4,000 years old have been found, but scientists studying human beings agree that humans were probably speaking thousands of years before that.Today, most of us learn to talk by the age of three, and for the rest of our lives we rarely stop. Even while we are reading or just thinking, we are in a sense "talking", if only to ourselves. Language is so much a part of human existence that we will be talking as long as we inhabit the earth. As linguist David Thompson notes, "When language dies, so will man."Text 2Once upon a time there was an old man who had three sons. Calling them together, he said, "Sons, my end is near. To my oldest son I give half my camels, to my second one-third, and to my youngestone-ninth." Soon afterwards he died.Now, the old man had seventeen camels, and the three brothers were puzzled to know how to share them as their father had said. They thought a long time about the problem, and it seemed that they must either kill some of the camels and cut them into pieces, or disobey their father. At last they went to see their father's old friend and asked his advice. As soon as he heard their story, he said, "I will help you. I honored your father. I am old. I have only one camel, but take it—it is yours."Gratefully the three sons took the old man's camel, finding that it was now easy to divide the camels as their father had wished. The oldest took half—that was nine camels; the second took one-third, which was six; and the youngest took one-ninth, which was two.Only when each had received his share of camels did they discover that there was a camel to spare. So, out of gratitude to their father's friend, they returned the camel.Text 3T: Before we start our regular lesson today, we're going to take about 20 minutes for a short listening test. S: Dr. Stark, why do we have to do it?T: That's a good question, and I have a good answer. You see, I belong to the TESOL organization—organization of Teachers of English to Speakers of Other Languages. I also occasionally help evaluate possible questions that might be on a TOEFL test.S: Do you mean you try to be sure they will be difficult questions?T: Not at all. We try to be sure that they are fair. And we want the questions neither too hard nor too easy, and as much like standard English as possible.S: Well, after we answer the questions, what will you do?T: I'll look at your answers, note which ones too many of you miss, and then perhaps give my opinion if I think it's a bad passage or dialog. All of your answers will go to ETS, the Educational Testing Service and there they'll decide which questions can possibly be included in a future test. OK, are you ready? Do you have any questions?S: Do you get paid for doing this?T: That's not considered a polite question in the U.S., but I'll answer it. No, I don't. I do this because I want to help to make good tests for international students. Now, no more questions. Let's listen.。

新编大学英语3视听说教程听力原文U4

Listen 1For many of you this will be your last year at university and now is the time for you to begin thinking seriously about your future careers. In order to give you as much help as possible, I have quoted a list of questions that you ought to ask yourself.First, "Have I got a clear knowledge of my abilities as well as my interests?" Be honest about your weaknesses as well as your strengths. Take a really good look at yourself and give real thought to the kind of person you are, and what kind of person you want to be.Second, "Do I know the kinds of occupations in which people like myself tend to find success and satisfaction?" Talk to people who have similar abilities and interests and who are already in the careers that interest you. You can gain some idea of what they consider to be important and challenging in those careers. Watch these people at work.Third, "Have I weighed carefully the immediate advantages against the long-term prospects offered by the jobs I am considering?" Will the occupation you select give you satisfaction in the years to come? Realize now the importance of education in all fields, technical and professional. Remember that chancesof promotion are usually given to educated persons—other things being equal.Fourth, "Have I talked with my parents, my teachers and my headmaster?" Remember they have a lot of experience that you can benefit from. They can help you think about the jobs. They can stimulate you to give careful thought to what you really want to do, and offer useful suggestions about how you might take full advantage of your personal qualities and qualifications.Last, "How do I regard my job? Is it just a means of getting money to do the things that I want to do? Is the work important to my future happiness? Is it a combination of both?"The above questions and their answers should give you some better ideas about how you should start planning your career. Your life-long job cannot be approached in any kind of haphazard fashion. It must be considered carefully, examined from every angle, and talked over with those who know you and those who can help you in any way.Listen 2I: Some people feel that their jobs are misunderstood by others. Is that very common?S: Oh, absolutely. Most jobs or professions have an image or stereotype attached to them, and some of these are not realistic. The serious point is that young people choose their careers based on these false images, and they may even avoid certain careers which have a negative image. This can cause problems for the economy.I: Is there evidence of this problem?S: Yes, there was a recent survey of children's attitudes to different professions.I: How was this done? Children don't know much about jobs and professions.S: True. What the investigators wanted to get was children's impressions and prejudices. They gave the children twelve pairs of statements, one of the pair positive, and the other negative. Children were asked to say which of the statements was "most true" for each profession.I: For example?S: Well, for example, "Such and such a person is likely to be boring or interesting company."I: I see. What professions did they ask about?S: The list is long, but it included lawyers, economists, accountants, sales representatives, scientists and engineers.I: And the results?S: Well, they are striking, especially for engineers who came out much worse than one might expect. About90 percent of the children thought that engineering was a "dirty job", of "low status", and the engineerwas more likely to take orders than to give them. The only other person they thought more likely to lose his job was the sales representative. But, there were good points too. Engineering was seen to be"interesting, well-paid work".I: Hmm, not a rosy picture.S: No, but it got better when children were asked what they thought of the engineer as a person. Most of them chose positive comments, but most thought the engineer was likely to be badly dressed.I: What about other professions? What were the most popular?S: Oh, the lawyers by far. Next came accountants and scientists as well as economists. The engineers and sales representatives were the least popular.I: Sounds like a sign of the times.S: Yes, but I think the most serious implication was the children's apparent ignorance of the importance of the engineer's role in society.Practice 1W: Look. Here's a job that might interest you.M: What is it? Are you sure? The last job interview you sent me off to was a disaster.W: Well, look. It says they want a sales manager, and it looks like it's a big international company. That'd be good. You might get to travel.M: What kind of company is it, though?W: Um, let's see. Yes, it's a textile company that seems to import from abroad. They say the salary is really good. They operate a system of paying you a basic salary and then offering you a sales commission on top of that. They say it is high. And oh, look! They give you a car to travel round in. That's not bad, is it?M: Um, do they say anything about experience?W: Um, let's see. No, they want someone young with ambition and enthusiasm. Oh yes, they want graduates, so that's OK. You've been to university. Now what else? Let's see.M: There must be some catch.W: No, the only thing is you have to travel, but then that's what the company car's for. Oh, and you have to be able to get on well with other people because it says you have to be good on a team.M: Um, perhaps I'll have a closer look at that one.Practice 2W: Now what do you want to see me about, Janet?J: Well, I have a few questions I'd like to ask you, Mr. Womack. Can you give me some information about secretarial jobs?W: Yes, of course. First, let me get your file out. Now you're 16, aren't you?J: That's right.W: Well, what would you like to know?J: About the opportunities in general and the basic training, and things like typing speed and shorthand speed.W: Before we go any further, Janet, when you said secretarial work, did you only mean typing or more general things?J: Well, I suppose I'd have to start as a word processor operator, wouldn't I?W: If you left school at sixteen, yes. But if you wanted to have a better chance of getting a more interesting secretarial job more quickly, it would be better if you stayed on and took A levels. According to your file, your English is good, and you've done French and economics, haven't you?J: Yes, they're my best subjects. If I stayed, what A levels would I need to be a secretary?W: That depends, but those three subjects are all very suitable.J: And then I suppose I'd have to do a secretarial course, wouldn't I? Um, what sort of speed do they expect?W: I've got the typing speed here, I think. Oh, yes, it should be 65 words per minute.J: And would I have to learn shorthand?W: Yes, you would. You'd need a speed of 90 to 100 words a minute.J: Oh, it sounds a lot, doesn't it? Would I have a chance to use my French?W: Oh, yes, if you were a secretary with languages.J: What sort of work would I have to do?W: Well, you'd have to translate letters, of course, but you'd also have to answer the phone to foreign callers and interpret if foreign visitors came to the firm. It would be useful if you learned a secondforeign language. That would help a lot.J: I think I'd like a job like that. But I'd better go away and think about it. You see, well, after all, two more years at school is a long time, isn't it?W: I'm sure it seems so at your age. If you need any more help, please come back and we'll talk about it again.J: Thanks, Mr. Womack.Practice 3D: Hi! You're listening to Radio Southwest, the best in the southwest for music and up-to-the-minute news.Sue's here. Hello, Sue.S: Hello, David.D: And we've got the Jobspot for you today. So, if you're looking for a new job, this could be the spot for you. So, let's have a look, and see what we've got today.S: Well, the first one we've got is a cook. That's in a large, busy restaurant, so it's very useful to have had experience in cooking. Must be a high school graduate and the pay is $12 an hour. So that's not bad, is it? The hours are good too. That's Monday to Friday, 3:00 p.m. till 6:00 p.m.D: Great. Thanks, Sue. So that's a cook. Now, how do you fancy working out of doors? How do you fancy being a gardener? So as long as you're fit and strong, and at least 16 years old, that'll suit you. The pay is $8 an hour. And the hours, Tuesday to Saturday, 8:30 a.m. to 5:00 p.m., you have to work on Sunday once a month, but on Monday the Garden Center's closed. Now, the sort of work you'd be doing is potting, watering, things like that. So, how about applying for that? Pay, $8 an hour. Sue, what else have you got?S: Right, Dave. Well, from outdoors to indoors. We've got a word processor operator job here. This job might suit a woman with school-age children, because the hours are only 15 hours a week. It's a small, friendly office, and they require a high school graduate with two years' experience operating a computer.Pay is $9 per hour. So, there you go. That's a nice job in an office. If you fancy any of those jobs, give us a ring here on Jobspot at Radio Southwest. And now back to the music.Practice 4A: Do you think anybody can be trained to be a teacher?B: Well, I think there are probably some people that can be teachers but I think it's a gift that you have.And not many people have that internal kind of thing.A: Can you define any of that?B: Oh...A: What sort of specific uh...are there certain personality...B: Well, I think that the best teachers are people that are fairly sensitive, and, er, extroverted, okay?A: Uh-huh...B: The best teachers I know are kind of extroverted people, and they really like kids...A: Uh-huh.B: But, by the same token, I know some teachers who really care about doing a good job and want those kids to like them and want to do well.A: Right...B: But for some teachers, they just don't have it. And it's...it's sad when you see that happening, because there're some teachers who don't care, you know—they're just in it now because they've been in it so long and it's too late to move out...and...A: Well, aren't there some very definable management skills involved in teaching that often are neglected in teacher training, maybe? I mean...B: I don't know how you train somebody to do that. To be a good teacher, I think you have to have a high tolerance level for confusion—I think you have...A: Um...B: To have that when you've got thirty kids... You have to have that. You have to be a very patient person, and I know it just sounds totally inadequate, but I don't know how to put my...my finger on it. It just... A: But you do believe it is uh...there is a gift of some sort, or there is something...B: Yeah, I do.Text 1There are at least 100 million workers in the Unites States. Most of them are on the job 35 to 40 hours a week. Their typical day includes seven to eight hours of work. Usually, they have a 15-minute coffee break in the morning and in the afternoon. But work schedules vary from job to job.White-collar workers—office workers and many professionals—usually have "nine to five" jobs. They begin at 9:00 a.m. and finish at 5:00 p.m. Monday through Friday. Blue-collar workers—mechanics, electricians, and laborers—often work from 8:00 a.m. to 4:00 p.m. In many factories, blue-collar workers come to work in eight-hour shifts. Typically, these shifts start at 8:00 a.m., 4:00 p.m., and midnight. Finally, sales people and managers in retail stores work on Monday and Thursday nights, when the stores are open. Many retail workers also work on Saturdays, and some work on Sundays.These are the normal schedules for most American workers. However, many businesses now use a new system called "flex-time scheduling". Under this system, the employees choose their own working hours. Some people work from 8:00 to 4:00 five days a week. Some work from 9:00 to 5:00. Other people work 10 or 12 hours a day four days a week. Employees and managers are both happy with the system. The employees like the freedom of choice, so they work hard. The managers, of course, like the hard-working employees.What, then, is a typical work schedule? It depends on the job—and on the workers.Text 2M: How long have you worked for AM-ADMEL, Gill?W: Only for a year. It's May now, isn't it? Yes, I joined last August in fact.M: August in 1996.W: Yes.M: What did you do before that?W: I used to work for a travel agency in London.M: It was interesting, wasn't it?W: Not really. It was just secretarial work, rather like this job. And it wasn't too well-paid. But I took a secretarial course when I left school and I couldn't think what else to do.M: So you went straight from school into a secretarial course, didn't you?W: Well, not quite. I left school when I was 16, in 1989, I think it was. And then I went to work in a hotel in Austria for a year, to learn some German.M: Austria? Why Austria?W : I don't know really. Well, we used to go there on holiday quite often when we were younger, and, well,I like Austria actually. Anyway then I went back and did the secretarial course. That was a year'scourse.M: And then you got the job at the travel agency I suppose.W: Yeah, that's right. That was in 1991.M: So you were there for five years!W: Yes, it's awful, isn't it? Actually, I'm thinking of giving it all up to become a nurse.M: Really?W: Well, I worked in a hospital in Twickenham during my last year at school. Just cleaning and helping to make beds and so on. It was part of our Practical Careers training.M: And you liked it?W: Yes, it was interesting.Text 3M: Well, now then, one thing I'd like to ask is, er, exactly why you applied for the job. I mean, just looking at your application form, you're actually over-qualified...W: Yes, I thought you might ask that. Um, the thing is, in my present job, although I'm actually in charge of a small team and I have a lot of responsibility, it's largely a desk job with a lot of paperwork...M: And you're not too keen on being stuck in an office all day?W: To be honest, no, I'm not. I much prefer being out on site where I can supervise things, and deal with problems as they occur. And this job should give me the kind of contact with other engineers, architects, builders and so on.M: Mmm. You'd certainly have to do quite a lot of traveling in the local area, you know, visiting different sites. You do realize, though, that the starting salary isn't as good as the salary in your present job?W: Yes, I realize that, but um, it does say in the job advertisement that the promotion prospects are very good.M: That's true, and er, as this is a new project that we're working on, we think there'll be a very good chance of fairly quick promotion, depending on performance, that is...W: Yes, of course. Well, you see, I've got very little chance of promotion in my present job. I mean it's a very small company and there's nowhere really for me to go; that's why I'm looking around for somewhere else.。

新编大学英语视听说教程3外研出版社听力答案

新编大学英语视听说教程3外研出版社听力答案Key to Unit 3V ocabularyI 1 1)threatens 2) by a small margin 3) civilize 4) closed up 5) wandered6) paste 7) without so much as 8) sideways 9) hook up to 10) universal 11) chart 12) Bathed in2 1) narrowed down 2) looked back on 3) cut off 4) fit into 5) wear (the other) down 6) lies in 7) put up 8) stand for3 1) which is likely to make people vulnerable to asthma has been found by researchers at the Department of Clinical Medicine in Oxford.2) with mirrored doors had to be built in so as to make their small bedroom look larger.3) feature the space shuttle Challenger blowing up in January 1986----killing all seven crew.4) threatened to keep the pupils in after school they were quieted at once.5) are a major barrier to the country’s economic growth due to the fact that imported oil has absorbed 40% of tis foreign exchange (because imported oil has absorbed 40% of its foreign exchange)4 1) looked back on atmosphere urban life2) era hooked up to the the electronic3) the suburb a sophisticated system analyze make errorsII collocation1 away2 inside/in3 forward/through4 back5 off6 home7 back down8 in outIII usage1 Internet is not such an unusual word as it used to be2 Most men do not look unattractive in them3. Wealthy as she is, she is not unconcerned by her sudden unemployment4. This claim is not unrealistic in view of a sharp decrease in the city’s violent crimes5. His poor health is not unrelated to his unhealthy way of lifeComprehensive exercisesI cloze1 Text-related1 Statistics2 rural3 era4 stood for5 on the latch6 vulnerable7 barriers8 electronic9 reflection 10 civilized2 Theme –related1 tougher2 liable3 shift4 electric5 cautious6 sophisticated7 thieves8 break9 chances 10 signsII translation1 The Internet is changing the way people live, no matter whether they are in urban or rural areas.2 Medium-sized and small companies are more vulnerable to the threat of the global economic crisis than large ones.3 With regard to our term papers, the professor asked us to analyze the chart of unemployment first, and then provide critical relections on the nation’s economic development.4 It never occurred to him that their team would win the basketball match by a large margin.5 Looking back on my twenty years’ teaching in high school,I attributed my success to patience, talent, and the constant pursuit of knowledge.2 It is almost impossible to keep a determined burglar out. All you can do is discourage him for a few minutes, thus exposing him to police patrols. Common sense tells us that lighting is a barrier to criminal activity. A light should be fixed in the doorway and switched on at night. Make sure that you don't leave the door on the latch if you happen to be the last to come in. If you decide to buy a sophisticated electronic alarm system, be sure to ask for its signs and put them up on both windows and doors. In addition you may have it hooked up to a police station.。

新编大学英语视听说教程第三册听力答案

Keys to the texts of book3Unit sixPart OneExercise 2 :1. d2. a3. b4.c5. c6. aExercise 31. farm animals; hold; feed2. small pets; toys3. buy; toss them out4. real shame5. dangerous; destructive ; bring diseases6. have a points7. humanely; limit8. time; money; warm place9. isolated; company 10. storm of debatePart TwoListening IExercise 11. b2. c3.d4. bExercise 21 T 2. F 3.F 4. F 5. T 6. TListening IIExercise 11.Her son.2. snake; crocodile3.quiet4.picky/particular Exercise 21. big2. dogs3.tiger4. bit5. cat6. friendly 6. eat 8. clear 9.wash 10.space 11. noisy 12. train 13. speak 14.keep 15. quietPart ThreePractice oneExercise 1(1,4,5,6,7,) yesExercise 21 a 2.b 3.c 4.a 5. dPractice TwoExercise 1(1,3)yesExercise 21. for free2.small donation3. 204. hundreds5. eat little6.50 7. animal shots 8. numerous shots 9. diseasesPractice ThreeExercise 11.c2.b3.d4.c5.aExercise 2(2,5.6.7) yesPractice FourExercise11 c 2.c 3. a 4.b 5. dExercise 21.crowding water; grass;2. what is happening; low3.targetpractice; over the area4. gotten rid of; stayPart Four Testing yourselfSection I1.f2. t3. f4. t5. f6. t7. t 8. f 9. f 10. tSection II1. a2. c3. d4. b5. b6. bSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5000 12. embarrassed 13. advertise the furs 14. export bans 15. importation 16.turtleKeys to the texts of book3Unit sevenPart OneExercise 2 :1. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery ;historic interest3. Summer ; too cold4. long history ; vast territory5. feed the monckys6. as many places as possible.7. you name it8.. host city ;ancient civilization; modern architecture9. city wall; treat yourselves 10.express train Part TwoListening IExercise 11 c 2. b 3. b 4. c 5. d 6. aExercise 21. SN 862 17:50 on July 112. SN863 15:10 on July 14 Listening IIExercise 1(B.C.F.G.H.I) yesExercise 2Part one 1.F 2. T 3.T 4.T Part two 1.F 2.F 3T 4.F Part three1.T2.T3.T .4.T5.FPart ThreePractice oneExercise 1Advantages: ADH ; disadvantages: EExercise 21 c 2.d 3.b 4. cPractice TwoExercise 11. seedypany3.shared4. noisy5. early6. private7. booking8. convenient9. restaurant 10.bathroomsExercise 21. T2. F3. T4. T5.6. TPractice ThreeExercise 11. Fuel2. Water3. Vehicles4. ClothesExercise 21.passing lorries 6. self-sufficient2.enough water 7. car repairs3.drinking 8. cost much4.vehicle 9. sweaters5.emergency 10. European winter Practice FourExercise1a. actress Bb. actress and author A1. a2.b3.b4. a5.b6. a7. a8. b Exercise 21.T . F 3. F 4. F 5. F 6. T 7. F 8.TPart Four Testing yourselfSection I1.F2.T3.T4. T5. FSection II My history teacher1. b2. c3. c4. c5. a6. dSection III1. d2. b3.c4. d5. aKeys to the texts of book3Unit eightPart OneExercise 2 :Section A5,7,1,4,6,3,2Section B1)F H I 2)A 3) C E J 4) B D G JExercise 31.passed out; in shock2. back and forth3. knows the reason why4. no doubt; living without her5. plays a great role6. brilliant boy7. very few cases8. deny; nature9. bright or not; should; CAN 10. thicker than; genetic relationship 11. react to; not to mention 12. hard decision; involvedPart TwoListening IExercise 11 F 2. F 3. T 4. F 5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed 8. language 9. young 10. alike 11. separated 12. apart 13. career 14. interestsListening IIExercise 11.b2.d3. a4. dExercise 2(1,4,6,8,10,11,12 ) yesPart ThreePractice oneExercise 1(3,6,9) yesExercise 21. six2. four3.1954. broad5. slim6. extended7. short8. elbows9. knees 10. size-14 11. lungs 12. heartPractice TwoExercise 11. 19212. fit the child3. ordinary schools4. adult conception5. BarbaraExercise 21. good being2.wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction9. scholars 10. scholars 11. street cleanersPractice ThreeExercise 11. c2.b3. c4. bExercise 21 F 2. F 3. T 4. F 5. FPractice FourExercise11 a 2. c 3. d 4. aExercise 21.F2. T3.T4. T5.T6. TPart Four Testing yourselfSection I1.talent2.dancing3.creative4. early5. physical6. energy7. less8. curiosity9. particularly 10. cause 11. fundamental 12. meaning 13. superior 14. fluently 15. read 16. exceptional 17 preparation 18. fullySection II1.F2. T3. F4. F5. T6. F7. F8. TSection III1. c2. a3. c4. b5. dKeys to the texts of book3Unit NinePart OneExercise 2 :1. c2. c E3. .c4. w5. w 6 c 7. c 8. c 9.c 10. w 11. w 12. w 13. c 14. w 15. w 16. c 17. w 18. wExercise 31.prefer; old- fashioned2. as old as3. account for4.own; play; earn a living5. very proud of6. had the chance7. hills; small bridges; singing of birds8. full of energy9. holes; buttons; precise; notes 10.indirectly; individualistic 11. places great importance on 12. a universal languagePart TwoListening IExercise 11 restaurants, airports supermarkets; banks 2. attitudes; in the right mood ; a better feeling; the people around him; happy; work better 3. world war II 4. happy; calm ; a machine; kinds of music ; different times; faster ; slowerExercise 21. T2. F3.F4.T5.T6. F7. T8.FListening IIExercise 11.eases their minds; operations2. classical; instrumental Jazz;folk music 3. reduce tension; 50 male doctors; Mathematics ; 1. quickly 2. calmly 3. chosen for them 4. no music 5. the worst sleepyExercise 21. T2. F3.T4. F5. FPart ThreePractice oneExercise 11. b 19622.d 19633.a 19644. c 1970Exercise 21. their own style2. the nature3. sounds; experimented4. songs; records5. films ; awardsPractice TwoExercise 11. (1) (2) (3)2.(2) (1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the string5. manages the bowExercise 3.1. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice ThreeExercise 11. T2. T3. T4. F5. F6. F7. F8. TExercise 2。

视听说iii原文和答案

VLS B3 Unit 1II. Basic Listening Practice1.ScriptW: Have you chosen your elective for next semester yet? Are you taking French writing again? M: Yes I am, but it’s compulsory for us next semester. So I think I’m gong to do marketing as an elective instead.Q: Which class will the man choose as his elective?2.ScriptM:Did you go to that businesses lecture on Friday? I missed it and need to copy your notes. W: I’d say you could borrow my notes, but Sarah’s got them. Be careful not to miss Professor Brown’s seminar; he takes attendance in that.Q: What is the woman telling the man?3. ScriptW: Wow, Steven! In the library! What brings you here?M: I’m enjoying the view. All the girls in fashion design are here are preparing for an exam on Monday.Q: Why is the man in the library?4. ScriptW: How’s your group doing with this statistics presentation? Mine’s terrible.M: Yeah, mine too. David and Mike are OK, but Steven doesn’t pull his weight and Suzie’s never around. I don’t see how we can pass unless Steven and Suzie realize that this is their last chance.Q: What is the true of Steven and Suzie?5. ScriptW: You took an MBA at Harvard Business School, didn’t you? What’s it like?M: It’s expensive, about . $ 40,000 a year, plus the costs of food and housing. But the teaching is first class. The professors have a lot of practical experience. They use the case system of teaching; that is, you study how actual businesses grew or failed. Q: Why is he MBA teaching in Harvard Business School first class, according to the conversation?Keys:III. Listening InTask1: On the First DayScript(Voice-over: Harison meets Jenny before the first class.)Harrison: I'm Harrison. Good to meet you.Jenny: Good to meet you. I'm Jenny.Harrison: So, you've bought the books for this biology class.Jenny: Yeah. I think everyone had to before class started. 'Harrison: No. Usually no one does much on the first day because it's still add-drop.Jenny: What's that?Harrison: Changing from class to class to find out which is best.Jenny: Have you had this teacher before? I've heard he is really good.Harrison: He's good if you're a hard worker. He expects a lot.Jenny: Oh, I guess that's good. I hope I can keep up with everyone else in the class. Maybe I need your help after class.Harrison: You're welcome.(Voice-over: Jenny catches up with Harison after the first class.)Jenny: Harrison, wait up!Harrison: So what do you think of the professor's lecture?Jenny: I think about half of what he said went over my head.Harrison: Don't worry. A lot of what he said is explained in the reading.Jenny: Hey, would you mind if I borrowed your notes tonight to look them over?Harrison: No problem. We don't have class until Wednesday. Here you go.Jenny: Thanks. I just want to make sure I'm prepared for the seminar.Harrison: Yeah. Participation in the discussion is an important part of the education here.Key(1)the first day (2)changing (3) really good (4) hard workers (5) went over her head(6) explained (7)notes (8)Wednesday (9) participation (10) educationTask 2: How to select elective courses?ScriptConsider these tips on elective courses and you'll choose those that will serve you best.To begin with, you should select the courses that fit your profession. It is a good idea to choose elective courses closely related to your chosen profession. Potential employers will appreciate every bit of extra training and knowledge that they don't have to give you. For example, you may select elective courses in chemistry, biology or even physics if you are doing a science major. For business majors, select electives in accounting, business administration, and even computing, as you'll never know when these will come in handy in the corporate world.Moreover, you can choose an education that includes many fields of study. If you are taking a heavy load of career-related courses, you may prefer electives that are not directly related to your major. If you receive a well-rounded education, some employers believe that you have better potential. For example, if you have courses in science along with your business degree, you could possibly win a job over someone who majored purely in business with no outside electives.Finally, you can also select a challenging elective course. Part of getting an education is learning how to learn, and elective courses should help you achieve this goal. You need not to memorize all the information from each class, but you should get a better understanding of the world. So, pick elective courses that challenge your belief system and make you look at the world in a different way. For instance, you can consider a philosophy elective if you have been told that you are a little narrow-minded.Key(1) extra training (2) chemistry(3) accounting (4) many fields of study(5) better potential (6) business degree(7) challenging (8) how to learn(9) better understanding (10) narrow-mindedTask3: How to Get Straight A’sScriptIt is interesting to note how straight A students achieve academic excellence. Here, according to education experts and students themselves are the secrets of super-achievers.First, they know how to set priorities. Top students allow no intrusions on study time. Once the books are open or the computer is turned on, phone calls go unanswered, TV shows unwatched, snacks ignored. Study is business, and business comes before recreation.Also, good students can study anywhere and everywhere. Claudia Hill, an Arizona State University business professor recalls a cross-country runner who worked out every day. Hill persuaded him to use his spare time to memorize biology term. Then he posted a list of biology terms on the mirror in the bathroom. He learned a few terms every day while brushing his teeth. Eventually, he scored high on the final examination.Moreover, top students schedule their time well. Study times are strictly a matter of personal preference. Some work late at night when the house is quiet. Others awake early. Still others study as soon as they come home from school when the work is fresh in their minds. All agreed, however, on the need for consistency. A student says, “Whatever I was doing, I maintained a certain period of time every day for studying.”Another important characteristic of super-achievers is that they know hoe to read, According to a book entitled Getting Straight A’s, the secret of good reading is to be “an active reader-one who continually asks questions that lead to a full understanding of the author’s message”.1.Which of the following is NOT mentioned about super—achievers starting to study?2.What did the runner do to score high on the exam?3.What is the good thing all top students agree on?4.What does the speaker mean by “an active reader”?5.What is the main idea of the passage?Key: 1B . DIV. Speaking OutMODEL 1 Y ou’re just going to have study hardNora: Only our first day back at school, and already I feel like I’ve learned a lot. Chris: Only our first day back at school, and I already feel like I’m up to my ears in homework.Nora: You’re going to have to hit the books if you want to keep your grades up. Chris: Tell me about it! I already have two reports, two books reports, a composition, an oral report, and a research project—all due before midterms.Nora: We could work together. Maybe some of my organized study habit would rub off onyou.Chris: Better yet, maybe you could do my homework for me.Nora: Forget it! That would be cheating.Chris: All right, all right. I have yet to write a term paper. Can you recommend any articles and books? You’d better find me the exact pages where I can find what I want. Nora: You could borrow ideas from references, but if you quote without giving the sources, you’re plagiarizing.Chris: The quiz next week will be a headache. If you don’t help me, I’ll have to prepare some study sheets and hide them in my hand when I take the test.Nora: Oh, no! If you’re caught, the professor will definitely give you an F. Probably, you will have to repeat the year.Chris: All right, I’ll take your advice. The library is going to be my new home, and in the dorm I’ll be burning the midnight oil.MODEL2 Which class do you prefer?ScriptChris: First period is math with Mr. Woods. I don’t know how am I going to stay awake? Nora: I like Mr. Wood. He’s interesting.Chris: He’s boring! He could put the entire basketball team to sleep—during the championship game! Who do you have for economics?Nora: Mrs. Jenkins. She’s smart. Students really learn a lot from her.Chris: She’s tough! You have to work hard in her class, or you’ll probably fail. Nora:No pain, no gain.Chris: Nonsense, You could have learned even more with Mr. Sharp. But not many students opt for his class.Nora: What’s wrong with him?Chris: Often, the highest grade he gives on a term paper is C+, and he usually fails half of the students.Nora: No wonder he’s got the nickname Mr. Shark. Well, how about PE? What are you doing this semester?Chris: That’s the worst part. In PE, we’re learning t’ai chi. I’m bored to death. Nora: Ha-ha! Not to rub salt into the wound, but our class is playing your favorite sport: basketball.Chris: Oh…that figures! This is going to be a terrible semester.Nora: This is going to be a great semester!MODEL3 Publish or perishScriptChris: Tell us, Professor Grant, What are your primary duties as a professor? Professor Grant: Well,I do a lot of research and writing.It’s rough being an associate professor. It’s publish or perish.Chris: So you spent a lot of time in your office?Professor Grant: Yes, but I also have to prepare class motes, give lectures, hold office hours. Teaching is an important part of being a professor.Chris: With all those responsibilities, you must make a lot of money.Professor Grant: I wish. Actually, I spend a lot of tome applying foe grants to fund my research. Then I can offer assistantships and scholarships to the worthygraduate.Chris: I see why they call you “the boss”. But being a professor sounds pretty competitive.Professor Grant: Actually, I think you were in one of my classes…Chris: Um….I think you’re mistaken, Professor Grant!Professor Grant: No, I remember very clearly now! You owe me an essay!Chris: Sorry, I have too much work to do for the Student Union Newsletter, andI have to work two jobs to pay for school.Professor Grant:So you get an F in this course.V. Let’s TalkInterviewee: It's a really difficult balance to strike, actually maintaining the (1)quality but making sure as many (2)young people as possible and older people as well-there's been a surge inthe number of over 25s applying, and we take many people who are over (3)25. But we've gotto get that balance right. It's going to be terribly (4)difficult for us next year. Hostess: Given the cuts that the (5)government announced a couple of weeks ago, and the numbers that we know in terms of applications, where are you going to draw that line? Are you goingto have to look at cutting intake in order to maintain the (6)quality of the courses? Intewiewee: We're trying not to (7)cut intake at the moment. But what it means is we're going to have to be (8)extra-cautious in the number of offers we make, because we simply cannot (9) affordto go over our quota of the number of places that we can offer. Because if we do, it meansthat we could be fined, or we just simply haven't got enough money to make sure the students'(10)experience is right. So it means that maybe last year we would allow a few (11) morepeople to have an offer. This year is going to be tougher.Hostess: Do you lay some of the (12)blame for the situation at the door of the government?Interviewee: If you look to France, Sarkozy is actually increasing the (13)budget for highereducation. Obama in the . has done the same thing. So we're just slightly (14)puzzled asto why the government seems to- be cutting back on higher education rather than pumpingmore money into what we think is a (15)service that is absolutely vital for the economy. VI. Further Listening and SpeakingTask1:ScriptHi, everybody. My topic today is “Problems with Our Educational System”.There are a lot of things in our educational system that I don’t agree with. It seems that educators just want to give standardized tests, which focus only on academic performance but neglect students’ abilities and interests in other areas. I think there’re a lot of people who are very intelligent, but haven’t had the opportunities they could’ve had,had they been educated in a broader-minded educational systems. I feel that a lot of courses that students are focused to take in high school are too academic, and, as a result, many kids lost their interest in learning.Educators have failed to recognize various kinds of intelligence. They often exert a lot of pressure on students to be as well-rounded as possible. I think being well-rounded isn’t really possible. And as a consequence some students who are believed to be intelligentcan’t get into good colleges if they, for example, haven’t scored well on the math section, even if they ate brilliant writers.Another thing that disturbs me is that the so-called “weak students”are separated from the rest of the school. Some kids are kept in a separate class id their grades are lower then others. And they’ve very aware of their social position, you know. I think it causes them to act in a way that is not really positive. They’re just acting in a way that they are expected to act. Often their grades go from bad to worse. And that’s pretty sad to me. I think that many of the kids in those classed are intelligent, but never actually realize their potential because of the way they are treated very early on in their education.Key(1) standardized tests (2) abilities and interest (3) interest (4) pressure(5)well-rounded (6) get into good colleges (7) the rest of the school (8) from bad to worseTask 2: The Final ExamScriptAt a university, there were four sophomores taking a chemistry course. They were doing so well on all the quizzes, midterms, labs, that each had “A” so far for the semester. These four friends were so confident that on the weekend before finals, they decided to go up to the University of Virginia and party with some friends there. They had a great time, but after all the hearty partying, they slept all day Sunday and didn’t make it back to school until early Monday morning.Rather than taking the final then, they decided to find their professor after the final exam and explain to him why they missed it. They explained that they had planned to come back in time for the final exam, but, unfortunately, they had a flat tire on the way back, didn’t have a spare, and couldn’t get help for a long time. As a result, they missed the final.The professor thought it over and then agreed they could make up the final the following day. The guys were relieved and elated. The next day, the professor placed them in separate room, hand each of them a test booklet, and told them to begin.They took at the first problem, worth five points. It was a simple question on a chemical reaction. “Cool,” they thought at the same time, each one in his separate room, “This is going to be easy.” Each finished the problem and then turned the page.On the second page was a question worth 95 points: “Which of the tires was flat?”Task 3 Harvard UniversityScriptHarvard University is the oldest institute of highest learning in her United States. Founded 16years after the arrival of the Pilgrim at Plymouth, the university has grown from 9 students with a single master to the present enrollment of more than 18,000students, including undergraduates and students in 10 graduate and professor schools. Over14, 000 people work at Harvard, including more than 2,000 faculties. Harvard has produces six presidents of the United States and 34 Noel winners.During its early years, Harvard offered a classic academic course based on the model of English universities, but consistent with the prevailing Puritan philosophy. Although many of its graduates became ministers in Puritan church throughout New England, the university never formally affiliated with a specific religious group.Under President Pusey (1953-1971), Harvard started what was then the largest fund-raising campaign in the history of American higher education. It was an million dollar program for the university. The program increased faculty salaries, broadened student aid, created new professorships, and expanded Harvard’s physical facilities.Neil L. Rudenstine took office as Harvard’s 26th president in 1001. As part of an overall effort to achieve greater coordination among the university’s school and faculties, Rudenstine encouraged academic planning and identified some of Harvard’s main intellectual priorities. He also stressed the important of the university’s excellence in undergraduate education, the significance of keeping Harvard’s doors open to students from families of different economic backgrounds, the task of as aping the research university to an era of both rapid information growth and serious fund shortage.1.What is main idea of the passage?2.How many teachers did Harvard have at the very beginning?3.What was the relationship between Harvard University and religion during its earlyyears?4.Which of the following is NOT mentioned as an achievement of President Pusey’sfund-raising program?5.What did President Rudenstine do?Keys:Viewing and speakingScriptHost: Well, David Lammy, the University Minister, joins me from Westminster. Now thanks for joining us this lunchtime, Mr. Lammy. How do these cuts_ tie in with your much trumpeted commitment to increasing higher education? Interviewee: Well, I think it's important to remind viewers that we will spend well over12 billion pounds on higher education this year and to also say that there will bemore students at university next year than ever before in our history. But what is important is that when they get to university, is that they have good facilities, good buildings, that they have good contact with their lecturers and, for students from poorer backgrounds that they receive a grant. And you know 40 percent of students who are going to university are in receipt of some grants. So we have to plan. . . Host: But there's going to be less money next year. That's the bottom line, isn't it? Interviewee: Er, we are asking universities to make a one percent cut in their teaching grant. That's 51 million out of a total budget of over five billion. Look, I think there are families across the country preparing for Christmas spending a bit less and they're, you know, it's a lot more than one percent that they're, they're feeling.So I think this is reasonable to ask universities if we are to ensure that we can continue to send more young people to university and we remain committed to that. Host: And briefly, what about these two-year degrees? This is a reduction in standards, isn't it?Interviewee: Well, we, we, we. . . It's important in this country that we remember thatstudents aren't just the classic 18- to 21-year-old undergraduates. We want mature students. We want more part-time students and over the last few years we've been growing the number of foundation degree, two-year degrees that ensure that transition into high university and high level skills. That's what we want to support and that's what we're indicating in the grant letter that we've sent to universities over the last few days.Host: OK. David Lammy, thank you so much for joining us.Interviewee: Thank you.Key(1) increasing (2) 12 (3) more (4) facilities(5) lecturers (6) poorer (7) grant (8) one(9)budget (10) less (11) young (12) classic(13) part-time (14) growing。

新编大学英语视听说教程3听力标准答案

Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly BExercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. T Exercise 21) outside world 2) at home 3) wave hello 4) bow5) look straight in the eyes of 6) openly7) look at my feet8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being awareExercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 T Practice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) EnglishPart Four Testing YourselfSection 11) upset 2) sensible 3) lecture 4) calm5) strength6) landed 7) waving 8) perfectly 9) wildly 10) beeSection II1. B2. B3. D4. B5. D6. A7. C 8. BSection III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond8) independent9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. C Exercise 21. T2. F3. T4. T5. F6. F Listening III Exercise 11) stayed around 2) mouse catcher 3)rats and mice4) got a paw 5) weak and thin 6) make a wooden paw7) fastened it 8) grow sleek and fat9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7.F 8.TPractice Two Exercise 11. C D J2. A E G H3. B F IExercise 21. A 2 .B 3. D 4.C 5. B 6. D Practice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. A Exercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7.F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beardListening III Exercise 11. B2. C3. D4. AExercise 21. 4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction4) species5) oxygen 6) economic 7) conservation8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America / pet food / enough protein/ develop2. much more/ Asia /Africa3. position / natural resources /gone down/steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against 11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease3. the drift4. registration5. resentment6. attractive7. educa￥tion services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ￥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and prejudices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy withSection II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. F Exercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable3. splendid4. prevents from achieving5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. B Exercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.T Exercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by10. sense11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Part OneExercise 21. D2. A3. B4. C5. C6. A Exercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debate Part TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particularExercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.D Exercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.TSection II1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory10. reduced11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. A Exercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages E Exercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking 8. convenient 9. restaurants 10. bathroomsExercise 21. T2. F3. T4. TPractice Three Exercise 11. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7)A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. D Section III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A 5，7，1，4，6，3，2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13. careers 14. interestsListening II Exercise 11. B2. D3. A4. DExercise 21. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.T Part Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16.C 17. W 18.WExercise 31. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slowerExercise 21. T2. F3. F4. T5.T6.F7. T8. FListening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makesthe notes4. on the strings5. manages the bow Exercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. TExercise 2Bruce Springsteen: communicative, direct, exciting, simplerSting: naturalPeter Gabriel：musicalBranford Marsalis: brilliant, humorous Youssou N’Dour：not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. TExercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 1 1. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 1 1. T 2. T 3. F 4. F 5.F 6.T 7.F 8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damaged Exercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days 8. give up 9. stop trying10. encounter risks11. to be brave 12. shut 13. give 14. hold 15. wings16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. A Section II 1. C 2. B 3. D 4.A 5. B Section III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black11. white 12. shaking 13. wet 14. sweet15. delicious16. angel 17. grave 18. nights 19. days 20. taste。

新编大学英语视听说教程3听力原文

Unite 1Practice oneTom: Hey, Bill. Do you have any plans for this weekend?Bill: Y eah, Tom. Cindy and I are going ice-skating on Saturday.Tom: Oh.Bill: Why do you ask?Tom: Well, I thought you might want to come over and study for next week's chemistry test. Bill: Study?! No way. Hey, what if I try to fix you up with Cindy's sister, Kristi. We could double-date. She's really outgoing, bright, and funny too.Tom: Hey, I still remember the girl you fixed me up with last time. She was very moody and self-centered. She couldn't stop talking about how great she was. I'm not sure if I can trust you, "Mr. Matchmaker".Bill: Oh come on. So I made a mistake last time. Cindy's sister is really different.Tom: Well, what does she look like?Bill: Ah. Looks aren't important. She has a wonderful personality.Tom: Right.Bill: Okay. She has long wavy blond hair and blue eyes. She's of medium height, just a little shorter than you are.Tom: Go on.Bill: She has a great figure, a nice complexion, and she has a sexy voice. Oh, and she has a tattoo of an eagle on her arm.Tom: A what?Bill: No, just kidding. By the way, she was the runner-up in the Miss California Beauty Pageant two years ago. Well, you're probably not interested.Tom: No, wait!Bill: Ah, just forget I ever mentioned it.Tom: No, I'm interested!Practice 2David: Barbara, before you go, could you tell me about these students that are coming into my class?Barbara: Oh, yes. Now, let me think, well, there's...er...Paul. He's a tall, slim lad w ith fair hair. V ery friendly face, lovely smile... He's particularly good with group activities, and he's a very helpful person to have in the class and very helpful with the other students. He speaks fluently, but does make a lot of mistakes! He doesn't seem to mind making mistakes. He asks a lot of questions...er...he tends to speak first and think later. But he's got lots of interesting ideas. David: Good.Barbara: Ah...Susan...Susan. Now, she's very lively, quick, and very bright. She talks all the time but not always in English.David: What? Is she difficult or anything?Barbara: No...she's quite young but she does behave in quite a grown-up way really for her age. It can be a bit difficult to actually shut her up sometimes and make her listen to you.David: Ah, right.Barbara: She's very nice. She has dark hair and dark eyes.David: Right, well...are there any other girls in the class?Barbara: Y es, there is Maria. She's Susan's sister.David: Y es.Barbara: Actually it's quite difficult to tell them apart although...er... Maria is slightly older. She's a bit plumper and has longer hair than Susan. She's not quite as bright as her sister and I think that makes her feel a bit inferior really. Well, you know, she sulks a bit when she gets things wrong or she misunderstands you. But on the whole, a very sensible girl.David: OK.Barbara: And then there's Peter, who's older than the others. He's got a sort of moustache, spectacles and wavy dark brown hair. He usually wears a jacket and sometimes a suit. He's very smart and takes notes all the time. He's also very serious and determined to learn as much as possible. He asks quite difficult questions but he doesn't mean to be nasty.David: Well, thanks, Barbara. It's all up to me now, isn't it? Have a good holiday, won't you? Barbara: Thanks.David: Bye.Practice 3:1. Pedro sleeps only six hours a night. He goes to school full-time and works part-time in the afternoons. At night he plays soccer or basketball. He's seldom tired and his favorite way to relax is to jog two or three miles.What kind of person is Pedro?2. Mr. Miller was teaching his fourth grade class how to divide. The students didn't understand. He had to repeat his lesson and explain the idea more slowly. Over the next few days he explained and explained the lesson until almost the whole class understood and knew how to divide.What kind of teacher is Mr. Miller?3. People in the High Street neighborhood don't buy their fruits and vegetables in the supermarket. They buy them from Mr. Smith's truck. Y ou can trust Mr. Smith. He never tries to sell any bad or unripe fruit. His prices are fair.What kind of person is Mr. Smith?4. Jake and Charles ran into the classroom. Each one saw the chair he wanted to sit on. Unfortunately, it was the same chair. They both sat down at the same time. Each of them had half a chair. Charles said he was there first and tried to push Jake off the chair. Jake said he was first. Both boys refused to move."All right, boys," said the teacher. "If you won't move, then you can sit like that for the whole period." Jake and Charles sat like that for the whole period until the bell rang. When they stood up they were stiff and sore."I don't care," said Jake. "I was there first."What kind of person is Jake?5. Room 46A at Travis High School was always the dirtiest room in the school. Many of thestudents threw paper on the floor. One day, Mrs. Duke had an idea. She fastened a basketball hoop over the wastebasket. Now the students love to practice throwing their paper into the basket. When they miss, they pick the paper up and try again. And that was the end of the problem.What kind of person is Mrs. Duke?Practice four:A number of visitors to the UK, who had traveled throughout the British Isles, were asked by a newspaper reporter what their impressions of the British people were. Here's a brief summary of what they thought.There were many different opinions among those interviewed: Some were very flattering, others very critical. The distinction between the English and the British wasn't always understood, but, on the whole, it seemed that the Scots were very popular with visitors. They were thought to be very friendly, even though one Dutch visitor confessed she'd found it hard to understand their English.A great number found the British generally reserved, particularly the English, although one Australian visitor called the English "the friendliest people in the world and most hospitable". But she did admit that speaking the same language was a great help.Some Asian businessmen, who had traveled widely throughout England, said quite openly that they found North country people "much nicer" than people in the South. When asked what exactly they meant by "much nicer", one of them said, with a playful smile on his face, "By muc h nicer I mean much more like us!"A few continentals praised "English courtesy", but the majority found it dishonest and dull. "Y ou're forever saying 'please' and 'sorry' when you don't feel pleased or sorry," one explained.A young student from South Africa had no views on the matter. He hadn't met any Englishmen, he said. The country appeared to be full of foreigners like himself.Part four Testing yourselfSection two:Tom; oh, that Mr. Taylor. He is so boring!Mother; what do you mean?Tom: his less ons put me to sleep. And he’s so quick-tempered, mum.Mother: quick-tempered? Mr. Taylor? Are you sure darling?Tom: yes, he gets angry very quickly.Mother; that doesn’t sound like Mr. Taylor at all!Tom: and do you know, he spends all the time looking at his reflection in the window, admiring himself.Mother: really/. And why does he do that/Tom: because he’s vain, that’s why! And conceited. He thinks he knows everything.Mother; oh, Tom. Be reasonable. I’m sure you’re exaggerating. Mr. Taylor seems suc h a nice, kind man.Tom: well, he isn’t. he is mean and cruel.Mother; cruel/ no how can a foreign teacher be cruel/Tom: because he only gave me two out of ten points in my history test.Mother: oh, now I understand. Tom, I think you’d better get on with your homework.Unit 2Practice oneAt one time animals and people lived together in peace and talked with each other. But when mankind began to multiply rapidly, the animals were crowded into forests and deserts.Man began to destroy many animals for their skins and furs instead of only for food. Animals became angry at this treatment by man and decided that mankind must be punished.The animals held a meeting, but they could not decide how to punish mankind. Finally the animals agreed that because deer were the animals most often killed by man, deer should decide how man should be punished.Deer decided that any Indian hunters who killed deer without asking pardon in a suitable manner would be made to suffer with painful stiffness in their bodies. After this decision was made, the leader of the deer sent a message to the nearest people, the Cherokee Indians. "From now on, your hunters must first offer a prayer to the deer before killing him. You must ask his pardon, telling the deer you are forced to kill him only because your people are hungry and need meat. Otherwise, a terrible disease will come to you."The spirits of the deer would run to the place where a deer had been killed and these spirits would ask the dead deer, "Did you hear the hunter's prayer for pardon?" If the answer was "yes", the spirits would be satisfied. But, if the answer was "no", then the deer spirits would track down the hunter to his house and strike him with the terrible disease of stiffness in his body, making him crippled so that he could not hunt deer again.Soon all of the animals agreed that this was a fair and just punishment. Each type of animal decided that they would also cause a disease in people who mistreated them.When the friendly plants of the world heard what the animals had decided as punishment for mankind, the plants decided that this punishment was too harsh. They had a meeting of their own. Finally they decided that each type of plant should provide a cure for one of the diseases which animals had caused for mankind.This was the beginning of plant medicines from nature among the Cherokee Indians a long, long time ago.PRACTICE 3:Every March, a flock of buzzards returns to the town of Hinkley, Ohio. No one really knows how long this event has taken place, but according to local legend the annual buzzard migration began nearly 200 years ago with a massacre."The first legend of buzzards in Hinkley, Ohio, goes back to the Great Hinkley Hunt on December 24, Christmas Eve, in 1818. The local settlers deciding that the township needed to be made safe for their livestock, gathered together about 400 men and boys, with guns and clubs and completely surrounded the township of Hinkley." As the story goes, the townsfolk began marching toward the center of town, drivingall the game in front of them, and killing virtually every wild animal they encountered."The settlers took some of the deer and the wild turkeys for the holiday dinners, but left all of the other dead animals out in the snow. When spring came, the remaining dead animals attracted many buzzards, and since 1819 they've been coming back here in March."Hinkley locals have come to appreciate the buzzards' annual return. In mid-March, on Buzzard Sunday, they celebrate the birds' arrival with costumes, exhibits and songs. PRACTICE 4:Almost seven centuries ago, in Central Asia, there lived a great king called Tamerlane. He was a mighty, powerful, conquering soldier, and his greatest ambition was that one day he would rule a massive empire stretching from the Atlantic Ocean in the west to the Pacific Ocean in the east. He made his imperial capital in the oasis city of Samarkand, which he planned to make the most beautiful city on earth. Many magnificent mosques were built and they were decorated with exquisite blue ceramic tiles on the outside, and with pure gold on the inside.Tamerlane, like the great oriental king that he was, had many wives, including a Chinese girl called Bibi Khanym. Now Bibi Khanym was the most beautiful of all Tamerlane's wives, and she was also the youngest. She was his favorite wife and was deeply in love with him.In order to demonstrate her great love of Tamerlane, she decided to build a magnificent mosque to honor him, while he was away fighting in a distant war. She engaged the best architect, who designed for her the most magnificent mosque you could imagine. And then she found the best master builder, who began work immediately. But as the weeks and months passed by, the master builder began to fall in love with Bibi Khanym. She resisted all his advances, but at last he threatened to leave the mosque unfinished unless she allowed him to kiss her just once. Bibi Khanym wanted the beautiful mosque finished more than anything else. She wasexpecting Tamerlane to return any day. So at last she agreed to let the master builder kiss her, just once.But that was her terrible mistake, for so powerful was the master builder's love for Bibi Khanym that when he kissed her he left a permanent mark on her face.King Tamerlane returned and saw the guilty mark on his wife's face. The master builder was executed immediately, and then, thinking that a woman's beauty can be a dangerous thing, Tamerlane ordered that from that day on all the women in the kingdom should never be seen in public without a veil to cover their face.PART FOURSection 1long long ago, there was a pretty girl named "Red Riding Hood" becasuuse she was always wearing a red hood. One day her mother asked her to take some snacks to her grandmother because her grandmother was ill. Her mother told her, “Don’t hang around on your way. Don’t leave the main road.”On her way, she saw a wolf. The wolf asked her where she was going and she told him that she was going to her grandmother’s hous. The wolf thought to himself how delicious she would taste. Red Riding Hood danced in the woods, picking flowers for her grandmother and forgetting what her mother had said to her.The wolf went to the grandmother’s house and ate up the poor lady. Then he waited in the bed for Red Riding Hood.As Red Riding Hood came into the grandmother’s house, she found her grandmother looked rather strange with very large ears, eyes, hands and mouth. And suddenly the wolf jumped out fo the bed and devoured the little girl.At that time, a hunter passed the house and heard loud snores made by the wolf. He went in and carefully cut the wolf’s stomach open because she thought the wolf probably eaten the grandmother. Then both little Red Riding Hood and her grandmother escaped from the wolf’s stomach. After that, Red Riding Hood remembered the importance of the mother’s words and never left the main road again.SECTION 2Moon was sad. She had spent many years looking at the people on Earth and she saw that they were afraid. They were afraid of dying. To make them feel better she decided to call on her friend Spider to take a message to them."Spider", She said, "The people of Earth are afraid of dying and that makes me very sad. Please tell them that they will all die sooner or later but it is nothing to be scared of."So Spider slowly made his way back to Earth, carefully picking his way down on moonbeams and sunbeams. On his way he met Hare."Where are you going Spider?", said Hare."I am going to give the people of Earth a message from Moon.", he said."Oh, you'll be far too long. Tell me the message and I'll take it there for you", replied Hare."OK! Moon wants the people of Earth to know that they will all die......", Spider started."Right! Tell the people of Earth that they will all die", said Hare. And with that, Hare disappeared off to Earth.Spider gloomily made his way back to Moon and told Her what had happened. Moon was very cross with Hare and when he came back to tell them that he had given them the message, she hit him on the nose! And that is why to this day, the Hare has a split lip."Y ou had better take the message yourself", said Moon to Spider.And to this day, Spider is still carefully carrying Moon's message and spinning the web in the corner of our rooms - but how many of us listen?SECTION 3:We don’t often know how a word or a legend associated with that word started; however, in the case of the American “cowboy”we do. The cowboy legend began in 1867 when the first transcontinental railroad was being built across the American West.A branch line of the new railroad went to Abilene, Kansas. In Abilence, a 29-year-old cattle merchant, Joseph McCoy, had a plan that made him a millionaire and put his name in dictionaries. His plan was simple. He knew that in the high grasslands of southern Texas ther were large herds of cattle. If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East, where they would bring good prices. He bought a lot of land close to the railroad in Abilene, where cattle could be kept before being shipped, and put his plan into action.McCoy advertised for ranchers and cow-handlers to bring their herds of cattle to his new railway cattle yard in Abilene. He offered $40 for each of the cattle, ten times more than anyone else did. One hundred days after his offer was made, the first herds arrived from the South. Each heard had two or three thousand cattle in it. In the next four years, McCoy shipped more than tow million cattle to the North and East. He soon became a millionaire.McCoy referred to the men bringing the cows to Abilene as “cowboys”. Soon there were at least 5,000 cowboys bringing cattle up to Kansas from Texas. Because the camera had recently been developed, many photos were taken of the cowboys and their long trips with the cattle. These photos were published in eastern newspapers and the cowboy became an Americans folk hero. Soon writers, such as Zane Gray, were writing books about the cowboys and their adventures. Thus the legend of the cowboy grew and developed into the 20th century.Unit 3Practice 1I took a trip recently into the heart of the Amazon Basin where one of the big issues facing our planet stands out: the balance between economic development and the conservation of natural resources. There is strong pressure in the country to harvest natural riches for short-term financial gains. Then there is intense international concern about the control of such development. The problem, of course, is that this is a one-way street. Rapid development, and wholesale harvesting of timber, oil, and the like, will soon lead to the Amazon desert, which would mean the extinction of halfour planet's animal and plant species and the depletion of much of the oxygen we breathe. This clearly impacts every one of us.The local people of the Amazon understand the delicate balance of nature. They've survived for thousands of years by making good use of it, not abusing it??something we can all learn from. And now tourism is playing a positive role in the equation. Travelers from more developed countries are increasingly interested in the natural world. As a result, they are fueling a boom in eco-tourism. This is in turn bringing valuable income into the region, raising awareness of critical issues and helping slow down the otherwise uncontrollable developmentPractice two:It isn't strictly true that one half of the world is rich and the other half is poor. It is one-third that is very rich and two-thirds that are very poor. People in the rich third don't realize the enormous difference between them and the other two-thirds. A very simple example is that a dog or a cat in North America eats better than a child in many of the poorer countries. A fisherman in South America may be catching fish which are processed into pet food and yet his own children are not getting enough protein for their bodies to develop properly. Although a lot of the world's natural resources come from these poorer countries, people in the richer countries are probably using much more of these resources than people in Asia or Africa. The richer countries are in a position to dictate to suppliers what kind of prices they are prepared to pay for these natural resources. In some cases the prices have gone down. In others they have remained steady. But the prices the richer countries get for their own exports have continued to rise. So, they are getting richer and richer, and the poorer countries are getting poorer and poorer.Practice 3:I kept seeing the news pictures in my mind. What could I do? I was only a pop singer --- and by now not a very successful pop singer. All I could do was make records which no one bought. But I would do that, I would give all the profits of the next Rats record to Oxfom. What good would that do? It would only be a little money but it was more than I could give just from my bank account. Maybe some people would buy it because the profits were for Oxfam. And I would be protesting about this disaster. But that was not enough.Practice 4:Marsha and Ed Gibson are sitting at the kitchen table. Ed is nervous and upset, andhe's smoking. Marsha's eyes are red. She looks tired. Their children, two boys, eight and ten, are sitting with them. Tony and George know that their parents are having problems. Now, their parents are telling the boys that they're going to get a divorce. Their mother is talking first. She's telling them that she loves them and their father loves them, too. But she and their father are having problems. They aren't going tolive together as a family anymore. It has nothing to do with the boys. The boys are going to live with her. They're going to stay in the same house, go to the same school, and be with all their friends.Now, their father is talking. He's going to leave the house this weekend. He's not going to move far away; he's going to be in the next town. Two weekends a month, the boys are going to stay with him. And, they're going to be with him one month in the summertime. He'll take his vacation then and they'll go to the beach. The boys can call him anytime. He's going to be nearby. It'll be better this way.Tony and George don't really understand what's happening. On the one hand, they know that their parents aren't happy. On the other hand, they want everyone to stay together.Section 2:Last month, the Wilsons went to Green Trees Park. Jim and Sally sat under the trees and talked and read. The children played ball.Sally decided to take a picture of the chidren. She took her camera and walked over to them. She focused her camera. Then, she heard a scream. Sally looked up. A man was stealing a woman’s purse. He was running in her direction.Sally thought fast. She took three pictures of the man. When the police came, she gave them the film.The next day, one of Sally’s photography was in the newspaper. Under it was the story of the robbery. In a few hours, the police knew the man’s name and address. They went to his house and arrested him. The man is now serving three months in jail.Section 3:In many countries in the process of industrializat ion, overcrowded cities become a major problem. Poor conditions in these cities, such as lack of housing, inadequate means of keeping places clean and healthy and lack of employment, bring about an increase in poverty, disease and crime.The over-population of towns is mainly caused by the drift of large numbers of people from the rural areas. These people have become dissatisfied with the traditional life of farming and have come to the towns hoping for better work and pay.One possible solution to the problem would be to impose registration on town residents. Only officially registered inhabitants would be allowed to live in the towns and the urban population would thus be limited. In practice, however, this causes a great deal of resentment, which would ultimately lead to violence.The only long-term solution is to make life in the rural areas more attractive, which would encourage people to stay there. This could be achieved by rewarding people for going and working in the villages. Facilities in the rural areas, such as transport, health and educaiton services, should be improved. Educaiton should include training in improved methods of farmingand other rural industries, so as to foster a more positive attitude to rural life. The improvement of life in the villages is doubly important, because the towns themselves cannot be developed without the development of the rural areas.Unite 4Practice 1W: Look. Here's a job that might interest you.M: What is it? Are you sure? The last job interview you sent me off to was a disaster.W: Well, look. It says they want a sales manager, and it looks like it's a big international company.That'd be good. You might get to travel.M: What kind of company is it, though?W: Um, let's see. Yes, it's a textile company that seems to import from abroad. They say the salary is really good. They operate a system of paying you a basic salary and then offering you a sales commission on top of that. They say it is high. And oh, look! They give you a car to travel round in. That's not bad, is it?M: Um, do they say anything about experience?W: Um, let's see. No, they want someone young with ambition and enthusiasm. Oh yes, they want graduates, so that's OK. You've been to university. Now what else? Let's see.M: There must be some catch.W: No, the only thing is you have to travel, but then that's what the company car's for. Oh, and you have to be able to get on well with other people because it says you have to be good on a team. M: Um, perhaps I'll have a closer look at that one.Practice 2W: Now what do you want to see me about, Janet?J: Well, I have a few questions I'd like to ask you, Mr. Womack. Can you give me some information about secretarial jobs?W: Yes, of course. First, let me get your file out. Now you're 16, aren't you?J: That's right.W: Well, what would you like to know?J: About the opportunities in general and the basic training, and things like typing speed and shorthand speed.W: Before we go any further, Janet, when you said secretarial work, did you only mean typing or more general things?J: Well, I suppose I'd have to start as a word processor operator, wouldn't I?W: If you left school at sixteen, yes. But if you wanted to have a better chance of getting a more interesting secretarial job more quickly, it would be better if you stayed on and took A levels.According to your file, your English is good, and you've done French and economics, haven't you?J: Yes, they're my best subjects. If I stayed, what A levels would I need to be a secretary?W: That depends, but those three subjects are all very suitable.J: And then I suppose I'd have to do a secretarial course, wouldn't I? Um, what sort of speed do they expect?W: I've got the typing speed here, I think. Oh, yes, it should be 65 words per minute.J: And would I have to learn shorthand?W: Yes, you would. You'd need a speed of 90 to 100 words a minute.J: Oh, it sounds a lot, doesn't it? Would I have a chance to use my French?W: Oh, yes, if you were a secretary with languages.J: What sort of work would I have to do?W: Well, you'd have to translate letters, of course, but you'd also have to answer the phone to foreign callers and interpret if foreign visitors came to the firm. It would be useful if youlearned a second foreign language. That would help a lot.J: I think I'd like a job like that. But I'd better go away and think about it. You see, well, after all, two more years at school is a long time, isn't it?。

新编大学英语视听说教程3(十单元)听力标准答案

Unit 1Part OneExercise 21. Mike C2. Sam E3. Ted D4. Simon A5. Lilly B Exercise 31. avoid power2. social outgoing3. reputation4. despite wittiest5. make up for protective6. describes7. perfectionist critical 8. matches 9. traits improved 10. get rid of characteristicsPart TwoListening I Exercise 11. F2. F3. T4. F5. T6. TExercise 21) outside world 2) at home 3) wave hello 4) bow 5) look straight in the eyes of 6) openly 7) look at my feet 8) shy and silentListening II Exercise 11. sensitive/ caring independent / understanding2. good friend3. life people4. learning being aware Exercise 21. B2. C3. A4. D5. BPart Three More ListeningPractice One Exercise 11. ice-skating2. chemistry3. outgoing bright funny4. moody self-centered5. wavy blond medium height6. unner-upExercise 21. T2. F3. T4. F5. F 6 TPractice Two Exercise 11. Four2. Colleagues3. Teacher4. Susan5. Barbara\ Exercise 21) Paul D E J 2) Susan B F 3) Maria C H4) Peter A G IPractice Three Exercise 11. Pedro energetic2. Mr. Miller patient3. Mr. Smith honest4. Jake stubborn5. Mrs. Duke creativePractice Four Exercise 11) F 2) T 3) F 4) F 5) TExercise 21) flattering 2) critical 3) popular 4) reserved 5) English1) upset 2) sensible 3) lecture 4) calm 5) strength6) landed 7) waving 8) perfectly 9) wildly 10) bee Section II1. B2. B3. D4. B5. D6. A7. C8. B Section III1) secretary 2) hard-working 3) efficient 4) private5) army officer 6) help 7) fond 8) independent 9) shy 10) fifteenUnit 2Part OneExercise 21. C2. B3. D4. B5.AExercise 31. in your hand used to belong to2. practicing with3. talked to each other why not4. ask for find a way5. manage to his own love6. so foolishly jealous7. all three of them8. peacePart TwoListening I Exercise 11. B2. B3. A4. B5. CExercise 21. T2. F3. T4. T5. F6. TListening II Exercise 11. A2. A3. B4. C5. CExercise 21. T2. F3. T4. T5. F6. FListening III Exercise 11) stayed around 2) mouse catcher 3) rats and mice4) got a paw 5) weak and thin 6) make a wooden paw 7) fastened it 8) grow sleek and fat 9) managed10) peered out cautiously 11) seized it with 12) eighteen micePart Three More ListeningPractice One Exercise 11. B2. A3. A4. C5. DExercise 21. F2.T3. T4. F5.T 6 F 7. F 8.T Practice Two Exercise 11. A 2 .B 3. D 4.C 5. B 6. DPractice Three Exercise 11. B2. D3. C4. D5. AExercise 21. F2. T3. F4. F5.F6. TPractice Four Exercise 11. B 2 . C 3. B 4. A 5. D 6. AExercise 21. F2. F3. T4. T5.FPart Four Testing YourselfSection 11. C 2 . B 3. C 4. B 5. A 6. CSection II1. T2. F3. F4. F5.T6. F7. T8. TSection III1.18672. shipped ( If these cattle could be brought to Abilene, they could be put on trains and shipped to cities in the North and East.)3. millionaire4. land5. cattle6. million7. cowboys 8. camera 9. hero 10. adventuresUnit 3Part OneExercise 21. D2. C3. B4. E5.AExercise 31. T2. F3. T4. T5.T 6 T 7. F 8.F 9. T 10. FPart TwoListening I Exercise 11. B2. C3. D4. AExercise 21. F2. T3. F4. T5. F6. TListening II Exercise 11. B2. D3. A4. DExercise 21. 30s2. male3. 1.904. long wavy5. heavily built6. light red sweater7. beard1. B2. C3. D4. AExercise 21.4. 5.7Part Three More ListeningPractice One Exercise 11. natural riches2.) desert 3) extinction 4) species5) oxygen 6) economic 7) conservation 8) valuable income9) awareness 10) slow downExercise 21. T2. F3. F4. TPractice Two Exercise 11. F2. F3. T4. TExercise 21. South America, pet food, enough protein, develop2. much more, Asia ,Africa3. position, natural resources, gone down, steady4. continued to rise5. getting richer and richerPractice Three Exercise 11. the first few seconds2. so thin3. beings from another planet4. focused on5. looked directly at6. All around7. until now8. despair, grief and disgust 9. started crying10. who was sleeping peacefullyExercise 21. 2. 3.5.8Practice Four Exercise 11. B 2 . C 3. A 4. CExercise 21) love 2) together 3) mother 4) house 5) school6) friends 7) father 8) month 9) beach 10) callPart Four Testing YourselfSection 11) complained about 2) work 3) got out of 4) on the ground 5) shocked 6) cold-blooded killing 7) investigation 8)drug dealing 9) concern 10) against11) strong views 12) using drugs 13) too early 14) respectable 15) accused ofSection II1. C 2 . B 3. A 4. B 5. CSection III1. overcrowded cities2. poverty, disease7. education services 8. rural lifeUnit 4Part OneExercise 21. Computer programmer2. computer engineering3. internship4. lecture competition5. computer programming skills6. impatient7. constructive 8. medical research 9. management10. ￥3,600Exercise 31. 2.4. 6. 8. 9.11.12Part TwoListening I Exercise 12.3.4.5.7Exercise 21. weaknesses2. similar abilities and interests / important and challenging3. education promotion educated persons4. parents, teachers / benefit /give careful thought /useful suggestions / personal qualities5. getting money / our future happiness/ combinationListening II Exercise 11. choose their careers2. avoid certain careers3.different professions4.Children’s impressions and pre judices5. lawyers6. accountants7. scientists8. most popular9. least popular 10. ignoranceExercise 21. T2. T3. F4. T5. F6. TPart Three More ListeningPractice One Exercise 11. D2. D3. A4. BExercise 21. sales manager2. salary3. sales commission4. a car5. travel round in6. experience7. university8. on a teamPractice Two Exercise 11.B2.B3. A4.C5. CExercise 21. 65 words 2 . 90 to 100 words3. with languages / translate letters/ answer the phone/ foreign visitors/ second foreign languagePractice Three Exercise 11. C2. A3. B4. D5. BExercise 21. ADF2. BF3. ACEPractice Four Exercise 11.sensitive extroverted2.kids3.doing a good job4. tolerance level5. patientExercise 21. T2. F3. T4. F5.TPart Four Testing YourselfSection 11. 100 million2. 35 to 403. 7 to 84. office workers many professionals5. 8:00 to 4:006. eight-hour shifts7. Monday Thursday Saturdays Sundays8.choose their own working hours/freedom of choice /happy with Section II1. D2. A3. A4. C5. DSection III1. B2. C3. C4. D5. AUnit 5Part OneExercise 21. B2. A3. C4. E5. D6. FExercise 31. over long distances2. look into3. five times4. individual / group5. sex-specific / males, females, strangers6. great apes7. teach /own kind8. raised/ held / look bigger9. round/ tail –wagging 10. feeding/ every directionPart TwoListening I Exercise 11. plays/ real people/ real life/ emotional problem/ loyalty/ popular2. public speech / make themselves taller/ political one-sided3. soft-soap/ praise/ kindExercise 21. F2. F3. T4. T5.T6.TListening II Exercise 11. C2. A3. DExercise 21. be understood easily2. necessary/ desirable5. anxiety / effectPart Three More ListeningPractice One Exercise 11. D2. A3. B4. A5. BExercise 21. permission / apply for2. application form / Web site3. regular mail / fax4. traveler’s checks/ credit cardsPractice Two Exercise 12. 3. 5Exercise 21. T2. F3. F4. T5.T6.TExercise 31. other native languages2. two3. more4. of their choice5. Spanish6. Indian Spanish7. English8. German9. FrenchPractice Three Exercise 11. learner/ teacher/ curriculum2. aptitude/ expectations/ goalsExercise 21. T2. F3. T4. F5.TPractice Four Exercise 11. C2. C3. A4. BExercise 21. Eggs and Toast2. realistic/ goals/ far better than/ forgetting3.determined/ personality/ culture4. unusual/ recite aloudPart Four Testing YourselfSection 11. religions2. exist3. 40,0004. cave5. moon6. birth7. records8.agree9. by 10. sense 11. ourselves 12. inhabitSection II1. F2. T3. F4. T5.F6.T7.T8. TSection III1. A2. D3. C4. D5. B6. AUnit 6Exercise 21. D2. A3. B4. C5. C6. AExercise 31. farm animals /hold / feed2. small pets3. bury/ toss them out4. real shame5. dangerous/ destructive/bring disease6.have a point7. humanely /limit8. time/ money/ warm place9. isolated/ company 10. storm of debatePart TwoListening I Exercise 11. B2. C3. D4. BExercise 21. T2. F3. F4. F5.T6.TListening II Exercise 11. Her son2. snake/ crocodile3. quiet4. picky/ particular Exercise 21. big2. dogs3. tiger4.bit5. cat6. friendly7. eat 8. clean 9. wash 10. space 11. noisy 12. train 13. speak 14. keep 15. quietPart Three More ListeningPractice One Exercise 11. 4.5.6.7Exercise 21. A2. B3. C4. A5.DPractice Two Exercise 11.3Exercise 21. for free2. small donation3. $204. hundreds5. eat little6. $507. annual shots8. numerous shots9. diseasePractice Three Exercise 11. C2. B3. D4. C5.AExercise 22.5.6.7Practice Four Exercise 11. C2. C3. A4. B5.DExercise 21. crowding / water/ grass2. what is happening/ low3. target practice/ over the area4. gotten rid of / stayPart Four Testing YourselfSection 11. F2. T3. F4. T5.F6.T7.T8. F9.F 10.T1. A2. C3. D4. B5. B6. BSection III1. conserve nature2. donation3. eggs4. meat5. oil6. handbags7. shoes8. fur coats9. ivory 10. reduced 11. 5,000 12. embarrassed 13. advertise the furs14. export bans 15. importation 16. turtlesUnit 7Part OneExercise 21. C2. B3. C4. D5. AExercise 31. fun holiday2. natural scenery/ historical interest3. summer/ too cold4. long history/ vast territory5. feed the monkeys6. as many places as possible7. you name it8. host city/ ancient civilization / modern architecture9. city wall / treat yourselves 10. express trainsPart TwoListening I Exercise 11. C2. B3. B4. C5. D6. AExercise 2Flight number SN 862 SN 863Time 17:50 on July 11 15:10 on July 14Listening II Exercise 1B C F G H IExercise 2Part 1 F T T TPart 2 F F T FPart 3 T T T T FPart Three More ListeningPractice One Exercise 1Advantages ADH Disadvantages EExercise 21. C2. D3. B4. CPractice Two Exercise 11. seedy2. company3. shared4. noisy5. early6. private7. booking8. convenient9. restaurants 10. bathrooms Exercise 21. T2. F3. T4. T1. Fuel2. Water3. Vehicles4. clothesExercise 21. passing lorries2. enough water3. drinking4. vehicle5. emergency6. self-sufficient7. car repairs8. cost mush / or be costly 9. sweaters 10. European winterPractice Four Exercise 1Occupations B a. actress A. b. actress and author1) A 2) B 3) B 4) A 5) B 6) A 7) A 8) BExercise 21. T2. F3. F4. F5.F6.T7.F8. TPart Four Testing YourselfSection 11. F2. T3. T4. T5.FSection II1. B2. C3. C4. C5. A6. DSection III1. D2. B3. C4. D5. AUnit 8Part OneExercise 2Section A5，7，1，4，6，3，2Section B 1) F H I 2) A 3) CEJ 4) BDGJExercise 31. passed out/ in shock2. back and forth3. knows the reason why4. no doubt/ living without her5. plays a great role6. brilliant boy7. very few cases8. deny/ nature9. bright or not/ CAN 10. thicker than/ genetic relationship11. react to / not to mention 12. hard decisionPart TwoListening I Exercise 11.F2.F3. T4. F5. TExercise 21. genes2. sex3. blood4. tooth5. mirror6. left-handed7. right-handed8. language9. young 10. alike 11. separated 12. apart 13.careers 14. interestsListening II Exercise 11. B2. D3. A4. D1. 4. 6. 8. 10. 11. 12Part Three More ListeningPractice One Exercise 13. 6. 9Exercise 21. six2. four3. 1954. broad5. slim6. extended7. short 8. elbows 9. knees 10. size-14 11. lungs 12. heartPractice Two Exercise 11.19212. fit the child3. ordinary schools4. adult conceptionExercise 21. good being2. wise3. realistic4. psychology5. freedom to be themselves6. discipline7. suggestion8. religious instruction 9. scholars10. scholars 11. street cleanersPractice Three Exercise 11. C2. B3. C4. BExercise 2 1. F 2. F 3. T 4. F 5.FPractice Four Exercise 11) A 2) C 3) D 4) AExercise 21. F2. T3. T4. T5.T6.TPart Four Testing YourselfSection 11. talent2. dancing3.creative4. early5.physical6. energy7. less8. curiosity9. particularly 10. cause11. fundamental 12. meaning 13. superior 14. fluently15. read 16. exceptional 17. preparation 18. fullySection II1. F2. T3. F4. F5. T6. F7.F 8 TSection III1. C2. A3. C4. B5.DUnit 9Part OneExercise 21. C2. C3. C4. W5. W6. C7. C8.C9.C 10.W11. W 12. W 13. C 14. W 15. W 16. C 17. W 18.W1. prefer / old-fashioned2. as old as3. account for4. own/ play/ earn a living5. very proud of6. 1.5 billion / had the chance7. hills / small bridges/ singing of birds8. full of energy9. holes / buttons/ precise notes 10. indirectly/ individualistic 11. places great importance 12. a universal languagePart TwoListening I Exercise 11. restaurants/ airports/ supermarkets / banks2. A. attitudes/ in the right moodB. a better feeling/ the people around himC. happy/ work better3. A. World War II / happy/ calmB. a machine/ kinds of music / different times/ faster/ slower Exercise 21. T2. F3. F4. T5.T6.F7. T8. F Listening II Exercise 11. eases their minds / operations2. classical / instrumental jazz3. A. reduce tension B. 50 / fifty male doctors C. MathematicsD. 1) quickly 2) calmly 3) chosen for them 4) No music5) the worstExercise 21. T2. F3. T4. F5.FPart Three More ListeningPractice OneExercise 1B D A CExercise 21. their own style2. the nature3. sounds / experimented4. songs records5. films/ awardsPractice Two Exercise 11. 1) 2) 3)2. 2) 1)Exercise 21. picks the strings2. as hard as3. makes the notes4. on the strings5. manages the bowExercise 31. learn2. carry3. popular4. satisfying5. progress6. easiest7. less satisfying8. most difficultPractice Three Exercise 11. T2. T3. T4. F5.F6.F7.F8. T Exercise 2Bruce Springsteen: communicative, direct, exciting, simpler Sting: naturalPeter Gabriel：musicalBranford Marsalis: brilliant, humorousYoussou N’Dour：not so heavy/ rhythmic/ sophisticated/unusualPractice Four Exercise 11. A2. B3. A4. C5. AExercise 21. T2. N3. T4. F5.TPart Four Testing YourselfSection 11. T2. F3. F4. T5.F6.T7.T8.TSection II2. 4.7. 8. 10. 12Section III1. falling2. nice3. cold4. inside5. raining6. tears7. happen 8. arms 9. fire 10. goneUnit 10Part OneExercise 21. F2. F3. T4. F5.T6.F7. T8. T Exercise 31. terrible rubbish / deafening/ stand2. slow-paced/ peaceful3. concentration on them4. dreamt of / afford5. dwell on the past / more freedom5. keep up with/ totally different 7. have a date8. on the Net/ not unusual 9. adapt to / we have been saying 10. kept complaining / let it bePart TwoListening IExercise 1 1. B 2. A 3. B 4. C 5. BExercise 2 1. T 2. F 3. T 4. F 5.FListening II Exercise 11. quietly2. myself3. pity4. sympathy5. Understanding6. favor7. rocking8. wrong9. tired 10. lazy11. same 12. luckyPart Three More ListeningPractice OneExercise 11. name of the ship2. number of people/ passengers3. names of the people/ passengersExercise 21. N2. F3. T4. F5. TPractice TwoExercise 11. T2. T3. F4. F5.F6.T7.F8. TExercise 21. marvelous2. shines3. lovely4. little team5. the best players6. football stadium7. public8. name 9. notice board 10. in two weeksPractice ThreeExercise 11. beginners’2. copy down3. days of the week4. an 8th day5. sure enough6. convince7. Australia8. that oneExercise 2 1. F 2. T 3. F 4. F 5.TPractice FourExercise 11. work, family, health, friends, spirit2. work / bounce back / marked/ damagedExercise 21. undermine your worth2. special3. set your goals4. take for granted5. meaningless6. slip through your fingers7. all the days8. give up9. stop trying 10. encounter risks 11. to be brave 12. shut 13. give 14. hold 15. wings 16. learn 17. treasure 18. retrieved 19. race 20. journeyPart Four Testing YourselfSection I 1. D 2. B 3. D 4.C 5. ASection II 1. C 2. B 3. D 4.A 5. BSection III1. interpret2. forest3. flowers4. chased5.run6. catch7. jumped8. giant9.long 10.black 11. white 12. shaking 13. wet 14. sweet 15. delicious 16. angel 17. grave 18. nights 19. days 20. taste。

新编大学英语3视听说教程听力原文U5

1、下载文档前请自行甄别文档内容的完整性，平台不提供额外的编辑、内容补充、找答案等附加服务。
2、"仅部分预览"的文档,不可在线预览部分如存在完整性等问题,可反馈申请退款(可完整预览的文档不适用该条件!)。
3、如文档侵犯您的权益，请联系客服反馈,我们会尽快为您处理(人工客服工作时间：9:00-18:30)。